CAZyme Information: KDQ34219.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ34219.1
• CAZy Family: PL4
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		94225.85	5.4914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:4730399-4733842(+)

Full Sequence      

MPPSDFKNADIPEIVESLTTDEAILLTAGVGFWHTHEIPRLGVPAIKVSDGPNGIRGNHF
FMGTPAKCLPSSTALGSTWDTKLIEEVGLKLLAPEAKLRAASVILAPTCNIQRNPLGGRS
FESFSEDPILSGLLAAAYVNGVQKGGIGTTIKHFVCNDKENDRLGYDSIVGDRTLREVYL
MPFMLAQKFAQPWAMMTAYNRVNGTHASENPTLLQKVVRDEWKYDGMVALSNRFGIYSID
LSVNAGLDLEMPGTNKWRTLDLMNRSIQSRKLTSRTIKQRAKKVLELVKKCANGAPEILD
GDGLERTVEKDEDRALMRRVAAESIVLLKNDANLLPLQPKSLKKVAIVGGNAKALVLSGG
GSAALKASYFVSPYEGIVNALKAAGDVEVTYSEGARAYMTMPTLDYDLSTEAGDRGWIGE
WYSHEDDESMVPLKTPIRTQYIDETRIFISTSTPNGITRRWSLRLKGYLSPRTQDTQFEF
GLTAAGRAKLYVDGELVIDNWTRQRRGEAFFGVGSEEERGVFPLKANTKHEIVVEYCNVR
GPADGDEDEAVMDSNPGIRLGGAEVQDADVMMAAAVDLAKDADAVIAVVGLNSDWETEGY
DRTTLALPGRTDELIEKVVRANKNTVVVTQSGSAITMPWIDSVSTLVHAWYLGNATGDAV
ADVLFGTKNPSGKLSMTFPRRLEDVPAHGHFNSENGKLIYGEELHVGYKHYHHRNISPLF
PFGYGLSYTAFSYSDLQTSAVEYTSDGPAVTEILTITNTGNLVGSEVVQLYIGQPQSISA
VTRLDHQLKAFAKVVDLVPGQSEKVVINLDKYTFSYWDTTFQAWVVEKGPYSVKVGRSST
DIVLHGTIEITKPFEWNGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	252	6.3e-55	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.76e-72	70	842	121	757	beta-glucosidase BglX.
224389	BglX	4.53e-61	20	383	40	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.32e-57	325	728	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	7.13e-33	1	810	33	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.81e-29	40	287	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAG59831.1|GH3|3.2.1.21	0.0	1	859	1	862
CDJ79822.1|GH3	0.0	1	858	1	859
CAC03462.1|GH3	0.0	1	859	1	861
ADX07318.1|GH3	0.0	30	835	20	814
AMK37826.1|GH3	0.0	1	859	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.84e-204	10	859	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.03e-199	10	859	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.36e-129	10	857	4	681	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.90e-107	15	842	9	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X42_A	1.47e-92	11	850	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	5.51e-235	10	859	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	5.12e-230	10	859	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.45e-229	10	859	5	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.05e-229	10	859	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.20e-228	10	859	5	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KDQ34219.1.