CAZyme Information: KDQ34100.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ34100.1
• CAZy Family: PL35
• CAZyme Description: glycosyltransferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	KL198004|CGC9	33792.59	8.7544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:4441726-4442619(-)

Full Sequence      

RNPFPVLYDQSNTPQSDPNALAVVSTLYSNNYAMSTAVLAHSIRSVNSTARLILLYIDGQ
VSEEALCISRASGWELLAVPRIAPPKGGKGVYYRFVDQYTKLNLWGLDKHGIDRLVYLDA
DTLVRRNFDELFNLPFSFAAVPDVYGPGNPQGFRLGFNAGVMAIRTSSSVLRDMKNNIET
ARYPIGQAEQAFLNLYYGVKAVRLPYIYNALISIKKRNRVLWEELKSHMSVIHYTERKPF
MLEGQPGERILTPEETETAIDIAQRDFERWAEEFGWWRSAYHSMMAKHGAEVKRCTL

Enzyme Prediction     

EC	2.4.1.-:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	21	240	1.8e-32	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.56e-44	22	235	2	206	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133037	GT8_A4GalT_like	1.39e-18	30	239	9	245	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	1.85e-15	23	235	1	242	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
215090	PLN00176	6.42e-11	22	234	24	258	galactinol synthase
224359	RfaJ	2.15e-10	113	241	99	245	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA68772.1|GT8	3.91e-32	8	246	43	283
QDS71243.1|GT8	6.09e-22	22	291	157	429
QWT23595.1|GT8	1.89e-21	22	249	3	259
CDS07125.1|GT8	1.45e-19	16	245	5	255
EGX53488.1|GT8	6.81e-19	22	239	36	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	1.73e-14	99	248	99	247	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3U2T_A	5.93e-08	7	209	18	210	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese [Homo sapiens]
3Q4S_A	3.09e-07	22	209	6	189	Crystal Structure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3RMV_A	3.09e-07	22	209	6	189	Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP [Homo sapiens],3RMW_A Crystal Structure of Human Glycogenin-1 (GYG1) T83M mutant complexed with manganese and UDP-glucose [Homo sapiens]
6EQJ_A	3.09e-07	22	209	6	189	Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form [Homo sapiens],6EQL_A Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens],6EQL_B Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8GWB7|GUX6_ARATH	2.72e-15	16	235	26	250	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|F4HZC3|GUX5_ARATH	9.92e-14	21	240	278	482	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=GUX5 PE=2 SV=1
sp|Q9FZ37|GUX4_ARATH	5.80e-13	21	241	271	474	Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=GUX4 PE=3 SV=1
sp|Q8GWW4|GUX2_ARATH	6.01e-13	18	241	298	512	UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GUX2 PE=2 SV=1
sp|Q9LSB1|GUX1_ARATH	2.75e-12	17	265	318	558	UDP-glucuronate:xylan alpha-glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=GUX1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ34100.1.