CAZyme Information: KDQ33988.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ33988.1
• CAZy Family: PL14
• CAZyme Description: carbohydrate-binding module family 21 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	KL198004|CGC12	87038.37	10.2661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:4153225-4155703(+)

Full Sequence      

MIATMSATTHIRMSPTPGRPFSLASNSAGAPLPLIPRRSAIRSNSTPASAQGSPPNATPI
KVVVEGPSPSKEYPKNSFNTNFPTASTAASGITPPVRRRVVPSRSVPTLCPPEHSTPTPA
VSLANVNNHPPLPDTGDDATPRASTSKPLTYQPGVSLRLNLDSLKNRSLSESRIDGLSGE
DSFEIPPAVEAQLIRKKSGQLVKSSLKRSKSSDRASLSVMMFAGPSKSEPTTPKAVHFDA
KLEHVKLFLAQQKPLAVSRDGSPTDDTSGTESDFPSFIFGSADERNARRNLTMKVTNMPI
IINTVHDVALEELKLSSDMTSIEGRVRLKNIAYHKQLGVRFTFDAWQTTSEVFGKYSEPI
NKNFDRFTFSIRLNDLLARIDGKTLLLALRYTVDGQEIWDNNSCQNYQAIFSTKRQPKNR
PDDSSSASDAADLKVRLEKVVRGREAGPATPTPRVSRQPGSRSNSSSSSSDSDKPLEFKT
NGSLASRYDLGSSLRAPWKSPVPAYTPPPQHSRTRSHPSTSPSQTSIPWPSKIVTTPTTQ
YNKSKAELGSPRDLSNDDHFRLVGTRLHTSPESENIPFPVMKPPVAKEQRASRNHQRGGY
FDVGANFETGVRKTPPGSPKSTAVDSVSGLASPRSISFPPSDGSLLPRPLFSTPTALDLT
PRQGLFALETGGDSESSTPTFIPSSESSRSSTPSPTDFAFTSLVDGFVDQLPPANAPVDY
RQLIDKFCFYTGTDTLPLRPSSASSVDDFFSSQSPRLQGSAHKFSSPPLTARSNSDDMIV
CRSGSATPVDRRTSPLGSRSPTPIAA

Enzyme Prediction     

No EC number prediction in KDQ33988.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	306	408	1.8e-27	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.85e-35	308	408	7	111	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.49e-08	330	407	1	73	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW00931.1|CBM21	1.77e-67	24	732	27	721
QRW15466.1|CBM21	2.05e-65	24	732	27	721
QRW26734.1|CBM21	2.92e-60	12	736	2334	3061
CCA70212.1|CBM21	1.02e-52	193	629	122	579
AUB26447.1|CBM21	1.33e-44	115	796	220	863

PDB Hits     

KDQ33988.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O95685|PPR3D_HUMAN	8.93e-10	308	407	177	275	Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
sp|P28006|GAC1_YEAST	1.43e-09	314	413	250	363	Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
sp|Q803M0|PPR3B_DANRE	2.71e-09	308	439	137	266	Protein phosphatase 1 regulatory subunit 3B OS=Danio rerio OX=7955 GN=ppp1r3b PE=2 SV=1
sp|Q5U2R5|PPR3C_RAT	5.95e-09	308	443	157	292	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	1.07e-08	306	410	155	257	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ33988.1.