CAZyme Information: KDQ33833.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ33833.1
• CAZy Family: PL1
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155	KL198004|CGC4	16675.65	3.9657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:3708504-3709157(+)

Full Sequence      

MQFSSKVLALALAVLPSAFAAPAQTDFRISPSVNTNKCLNVRGNLLANGTAVDIFDCNRS
AAQNWVINPGSTSVQLSGTDFCLDAGSSPANGVGMKIWQCFDSLPAQEWFLTSDDRIALE
NQGFCLDLTNGDVTNGNQVQIWQCTDNDVNQAWVL

Enzyme Prediction     

No EC number prediction in KDQ33833.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	32	154	2.8e-22	0.6436170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	2.65e-18	27	153	1	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	3.68e-17	32	153	7	126	Ricin-type beta-trefoil lectin domain.
411518	lectin_1	1.27e-16	9	155	689	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	3.17e-13	78	155	9	84	Ricin-type beta-trefoil lectin domain.
238092	RICIN	4.96e-12	76	155	6	82	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	9.97e-43	10	154	21	163
AGV14186.1|CBM13	1.11e-29	12	153	7	162
AUB23598.1|CBM13	1.11e-29	12	153	7	162
AFR93997.1|CBM13	1.11e-29	12	153	7	162
UOH83865.1|CBM13	1.27e-29	12	153	7	162

PDB Hits     

KDQ33833.1 has no PDB hit.

Swiss-Prot Hits     

KDQ33833.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000175	0.999796	CS pos: 20-21. Pr: 0.9864

TMHMM  Annotations     

There is no transmembrane helices in KDQ33833.1.