CAZyme Information: KDQ33683.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ33683.1
• CAZy Family: GT90
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		93190.21	6.5073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:3291166-3294350(+)

Full Sequence      

MTDSRSFLEASIPELIKKLTVNEKIDLLGAPNWWNTSPIDRLKIPSIRMSDGPNGVRGSS
HFVSTPSQCLPCATSLAATFDPQLIHEAGAFLAQEAKTKSSVVLLAPTCNIPRSPLGGRA
FESFSEDPHLSGVMAAAYVNGLQSEGVSATIKHFVANDQEHERTAAESVMSERALREIYL
YPFMLAQKHAKPGAFMTAYGRIGGLHCSENPTLLQGILRDEWKFNGIVMSDWFGTYGVSE
PLNAGLDLEMPGPPRWRTPVLIHHSLTAQKLLLPTINERVTNLLTFIQQQAKRNPDIVYG
DGVERSRDSPEARQFCRRLAAEGMVLLRNQRDTLPISQVKQIAVIGPHVQERIISGGGSA
ALKPTYVTTPWQGIQNAVPKGVTTVYTVGCYAHKYLPTLENNLTTPDGKSGWLCTFYNQD
ANGKPTKAVADFILNDTRVKLNDFLPSGLADEWTIKLSGKLMVETSGLYELGLTVAGRAK
LFVDGKLTIDNWTKQTPGDFFYGQGTIEETAVIELKAKSAVDILVVYTNTSPIDDGPDDE
VAASQPALMRGVRLGGCPKIDPDQAIQEAVDLAAKSDVVIYIGGLTPEWESEGFDRPSLQ
LPGRQDELITKLSRANPNTVVCIQAGSAVSMPWVDDVNGIIQAWYSGNEAGNALADVLFG
KINPSGRLPLTLPVRIEDVPSHLCTRSENGKIHYREDLFVGYKHYQAKYIKPLFSFSHGL
SYTKFELLRVGCAMLPEQPFGLEVSITVKNIGSTTGSEVIQVYVAYPQRHLIHPKLQLKG
FAKARDLRPGSSTTVTIKLDKYAVSYWDESSHKWVASAGEYGLSFGTSCDNIALESKFEV
KETFSWLEL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	39	251	5.9e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.21e-66	9	827	35	752	beta-glucosidase BglX.
224389	BglX	5.64e-65	41	383	57	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.11e-54	324	702	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.77e-37	70	285	88	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.18e-37	6	800	41	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO99100.1|GH3	0.0	4	849	16	880
QRV86694.1|GH3	0.0	1	846	1	843
QRW15251.1|GH3	0.0	1	846	1	843
QRW00750.1|GH3	0.0	1	846	1	843
ABL67526.1|GH3	0.0	1	846	1	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.48e-215	12	846	6	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.48e-210	12	846	6	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.96e-133	12	843	5	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.21e-107	16	833	9	656	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	4.40e-100	14	828	56	816	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	3.00e-230	9	847	11	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	5.86e-229	9	849	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	5.86e-229	9	849	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	5.86e-229	9	849	3	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	3.42e-228	12	849	6	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ33683.1.