CAZyme Information: KDQ32900.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ32900.1
• CAZy Family: GT2|GT2
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		71860.86	8.2227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:1313024-1315224(+)

Full Sequence      

MQAGLFSGHWSHNHLDAYPDQIVEESYWGSQAAKFLRLAESTKKVVREHPIPKLMDQAEA
RFREKVDRQSKTLQAAVKEYKRRYERNPPKGFDEWWQFAKANNATFVDEYDGLVSDLAPF
WSLSGAELRRRTEQVGQLPSIDLVRLEKGKTSIIKNDDFRDSEAMARAHGFRRMIERFQD
KLPDMNFPVNAKAEGRVLVPWEHQKYPNLTKQDSSGGVEDMLGGPFPADWRGNGNVWEAW
RRTCPPSSPARRLFASVRNTFTKKVPNYLAANHTSPGNDFSFVPATASKFDFCEKPHAHY
TQGHFFSDWRTIPVLYPVFSPAKTAGYLDIRIPSHYYYGSTKRYTYGWDPVNMVLKEVDD
MEKPWEAKVDKIFWRGASTGGGSHPPGFSHQYQRHRFLRMTSDTSDANRTITFEDPPGSK
NFVSAAVPLAKLNEEIMDVAFVKITDAENYPGGLPAMQQHHRMADSVPLGRHWAYKYLID
MDGMGYSGRFMAFLASDSAALKATIYEEFYSDWIEPWVHFIPLSNSYREIYNIYAYFSGP
TNSTIQAVNGTQTQGDSDSEFPPPLEPEPRLSVEGNRRLRRIARAGKQWKKTIGRTIDME
VYVYRLCLEWARLFADDRDSMDFNL

Enzyme Prediction     

No EC number prediction in KDQ32900.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	298	614	7.3e-64	0.964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	9.87e-40	279	541	4	215	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.00e-09	317	526	108	268	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA73884.1|GT90	7.43e-260	28	624	57	657
AAW46283.1|GT90	5.22e-258	15	624	28	639
AAD44757.1|GT90	5.22e-258	15	624	28	639
KGB77320.1|GT90	5.22e-258	15	624	28	639
ADV25019.1|GT90	1.05e-257	15	624	28	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.44e-06	317	537	154	337	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.10e-49	34	623	135	667	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	2.57e-07	309	529	156	337	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	7.59e-06	317	537	166	349	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ32900.1.