CAZyme Information: KDQ32876.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ32876.1
• CAZy Family: GT22
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
128		14162.81	7.9446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:1241095-1241628(+)

Full Sequence      

GVQIHPNFSSNKCLDVRGNTLANGTPVQIYDCNGTGAQKWAISRGQTHVRLAGTNFCLDA
GSRPGNGVGMKIWTCFDNLPAQEWYYTGDNRIALFNKGLCLDLTDGSLTNSRQTQTWKCT
DFNTNQIW

Enzyme Prediction     

No EC number prediction in KDQ32876.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	8	128	1.4e-22	0.6329787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.40e-22	7	128	7	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	5.23e-22	2	128	1	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.60e-16	10	128	6	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	1.02e-15	9	119	719	826	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
411519	lectin_2	6.80e-13	11	128	127	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	1.78e-52	4	128	37	162
AGV14186.1|CBM13	3.29e-40	2	128	34	162
AUB23598.1|CBM13	3.29e-40	2	128	34	162
AFR93997.1|CBM13	3.29e-40	2	128	34	162
UOH83865.1|CBM13	2.24e-39	2	128	34	162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B2H_A	1.86e-06	7	44	244	282	Crystal structure of HA33 from Clostridium botulinum serotype C strain Yoichi [Clostridium botulinum],5B2H_B Crystal structure of HA33 from Clostridium botulinum serotype C strain Yoichi [Clostridium botulinum]

Swiss-Prot Hits     

KDQ32876.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000024

TMHMM  Annotations     

There is no transmembrane helices in KDQ32876.1.