CAZyme Information: KDQ32698.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ32698.1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	KL198004|CGC28	42323.14	5.6774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:679322-681503(-)

Full Sequence      

CSVRPLGAGRDDTEQVRYTAPRITGDTMTWDLRDSRVDVHGVLSVSMRIIPDSEVNVDFQ
PDIEYWLNATNTYRVVFIQSQASWFVVTGENFVIDGHNTGGIDGNGQPWWSFFATRTRAD
GDGRPISFTLWRTTNALVKDFHIQAQPFWCNTVAESQGVIYDGMKCNASNSDPSFAGKNI
VPNTDGINTYRSTNVSLLNWDITCGDDCLAIKGNSTDLTVRNITCRGGNGIAFGSLGQYA
NLSDNVRNVDMRDLKMIRIDPNIQPNMGNGVYFKSWTGTVNGSPPTGGGGGTRVVDNITI
SNVLLDRVNAPLHLYQTNGGHSGDTPSQLKFGGLRFSNWSGTALTNKSCQEVVFEDFSVA
GPQAQAPRFICQNVRDLSGLGGKSLLPT

Enzyme Prediction     

No EC number prediction in KDQ32698.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	50	375	9.7e-58	0.8861538461538462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	4.47e-30	58	374	21	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	7.98e-21	84	364	149	413	polygalacturonase ADPG
215120	PLN02188	1.51e-19	99	375	127	391	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	3.37e-17	84	316	136	338	Probable polygalacturonase
215540	PLN03010	1.60e-14	182	374	205	389	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD14403.1|GH28	8.26e-65	1	380	32	434
ABD61566.1|GH28	2.30e-64	1	373	32	428
CAK44162.1|GH28	3.08e-63	1	314	30	340
BCR93142.1|GH28	3.50e-63	1	344	32	378
BCS05796.1|GH28	3.50e-63	1	344	32	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HG8_A	3.39e-18	86	361	65	323	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
4C2L_A	7.05e-17	52	367	69	363	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
7E56_A	3.13e-07	87	308	65	254	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVE_A	3.22e-07	87	308	73	262	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.22e-07	87	308	73	262	Chain A, endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2EQQ2|RGXA_ASPNG	1.47e-65	1	380	32	434	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	4.08e-65	1	373	32	428	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	1.82e-62	1	373	31	427	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	1.82e-62	1	373	31	427	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|A2RAY7|RGXC_ASPNC	1.63e-47	59	353	89	377	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000005

TMHMM  Annotations     

There is no transmembrane helices in KDQ32698.1.