CAZyme Information: KDQ32610.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ32610.1
• CAZy Family: GT2
• CAZyme Description: Alginate_lyase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A067P040]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		52208.18	4.5595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198004:447933-449769(+)

Full Sequence      

MLPTLATSNTFFRVLAIFNLFASLTSVHAATSYANDFVDPDYILAKDYGSSGSPAKLTIA
GWARELAAKGPWTVTNKTATPPTGDKRTYMSWAPYWWPDCSQAGNTTALSDEQVWTTCRY
ISRDGIFNPDARLVVNDVGAFQDLSDAVLYNAIAWALSNATSNEYSKNVVNFVNTWFLDE
TTGMLPNLDYAQQIRGPGDPKGSHTGVLDLKGMSKIVSGILILRKGNCPDWTSELDARMD
DWSKRYITWLETADLAIEEALSTNNHGSFYYNQLAALYLLVNNNPAARNVTDTFFRGIYM
NQIEANGEQPLEAARTRPYHYRAYNLAAMITNARIGIYAAPDAPSPFQFKTSQGATIQSA
LDFAITFKASDSKEDNYASELNPNVAAVAAEYGDPDGKYAGYLKVNEPDYPAEAWFLWNQ
PLSDSGLSAQASMSGVASGPEPTTSTRPSTGASDNGGVSVRNGGVAAILLGFLSASIALW

Enzyme Prediction     

No EC number prediction in KDQ32610.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	74	372	2.4e-77	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.05e-49	73	367	1	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV83646.1|PL38	9.55e-162	19	461	12	443
QRW05956.1|PL38	5.46e-161	19	461	12	443
QRW12314.1|PL38	5.46e-161	19	461	12	443
QRW24462.1|PL38	5.84e-161	31	464	23	444
QRV97757.1|PL38	2.90e-158	19	474	12	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	1.76e-35	53	367	27	320	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

KDQ32610.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000297	0.999661	CS pos: 29-30. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in KDQ32610.1.