CAZyme Information: KDQ31782.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ31782.1
• CAZy Family: GH79
• CAZyme Description: glycosyltransferase family 24 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1537		171014.56	4.7293

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198005:452632-458975(+)

Full Sequence      

MTPSRGFRRVAVLLVLPCLVHSTSPPVRVSLRSSWPAPPPIVEILETVALQTPSSFFPLL
DALTDPDTLANFPSLSPEALYQASIEVASENGLITDAGAFAAVEMNLALHAATPKIEAFY
HHYSNMQSKGTLKPDYTRPKVLPFDHINPSPQQTLDRPHRTAVLYASLESPNFRELHSYL
FSLSNRGDPHVEYILRYVPPAGREVAQRNYLSGYGVALDLKKTDYLVVDDRQASQSRDGS
QGEQRDGEDAVDLVMNLLETFEDKKGDAPNVASALSEEEIAELGFQATQLIATSDDPLGA
LTQLSQNFPKYAPSLSRRVVVNDSVRRELGNNQVQVQGGINMMWLNGATVQDKDVTPFAL
LRLLQRERQIVDSLTSLGLSNGQAVELLTHPTIAEAQSSSAALDGMFDASDRIEGGDVIV
YWNDIEKDKRCALPMMHPTYPGMFHNIKLNIYNVILVVDLSQPTALNFITGPVSNIIERN
FPFRFGIVPILETENGTKMAKVFKYLVKTVGRKATMEFFRALTQSPTFDIAHVSVAYEAF
RASLDSEDISLKPLAEILSPEAESDESLMKAKHYAQRLGTTLTSSEGGHAFINGKHFNLD
DVRVSLCSFDLLYTGELKEEAAETISTYFYDLPSTNERRNRYIYPSSDANSLRIYSLPEV
LADTGYHPIFIAPEDTEDVPMSTYVIADFDNSSGVQLAIEALKSMLQLPQTGGSQTRLTF
VHNPASVPSSDRSSVSWLLSHLVASDRLSKVTPGQLLRALNNDVTISGDAAQAPLSQVKE
LVGVDAAEFDATAYAAYVRAGRLISRKVNLQPGQQGLVVNGRVVGPLPGGEFLAPDFLAL
MKYEHKKRFGVVAAVLREVLSLAPEPESTSFSNIATMVTSVISSIQLPDPSESGLFDTPH
RPRRRAYQALESNLTAFSFGDNTTAIYQLAVLVDPLSETGQKWASILNWISKVPGIFIEV
YLNPARYREMPLKRFYRYNLISSLTFDMDGNEIPSRVVFEGLPIEPIYTLAMDVPSSWLV
RPQEALYDLDNIQLGRLSSEDTTIDAVFGLDYLVIEGHARDSVSNAPPRGVQLELIDGDD
NAIDDTLVVANLGYVQFKAKPGVFQLQIRKGRGRDIFEMESVGNEGWDSPTVKAVGSEIT
LTSFEGLTLYPRLRRKEGMDDVDVLTDTDEEDAPGMFGGLASKVMSIFSPKEGTKDVATT
IPQADINIFTVASGLLYERFASIMILSVLRNTKSTVKFWFIENFLSPSFLEFIPHFAEEY
GFQYELVTYKWPSWLRQQKEKQRVIWAYKILFLDVLFPMDLKKVLFVDADQIVRADLKEL
VDLDIQGAPYAYTPMGDDNYDMEGFRFWKTGYWKEFLQGRPYHISALYVVDLVRFRQIAA
GDMLRGQYQQLSADPNSLANLDQDLPNNLQREVPIFSLHEDWLWCETWCSKDRLHKAKTI
DLCQNPLTKEPKLSRARQIPEWEEYDAEISRFAQKLAKEGSLHSRIAAADTRVLADAGTA
SSGKSDETSAEAGGGDPASNEAAREKEESPKDIRDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1206	1453	3.4e-127	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1206	1472	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.54e-176	1206	1453	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	1.48e-59	407	643	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.22e-55	1056	1159	1	102	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
132996	Glyco_transf_8	5.29e-55	1206	1453	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA74280.1|GT24	0.0	26	1495	26	1546
QRV75871.1|GT24	0.0	5	1498	2	1556
QRV90671.1|GT24	0.0	5	1498	2	1556
QRW18757.1|GT24	0.0	24	1498	23	1492
QRW04776.1|GT24	0.0	224	1498	2	1322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.56e-284	22	1479	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	3.09e-284	22	1479	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	4.74e-283	22	1479	6	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	6.22e-253	24	1415	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	2.33e-238	22	1479	6	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	4.67e-220	6	1479	4	1431	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	2.88e-209	22	1485	25	1520	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.20e-197	9	1479	24	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.14e-197	1	1471	18	1522	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q0WL80|UGGG_ARATH	8.29e-196	139	1491	176	1588	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999720	CS pos: 22-23. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in KDQ31782.1.