CAZyme Information: KDQ31558.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ31558.1
• CAZy Family: GH74
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	KL198006|CGC15	32436.19	4.2806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:4447165-4448400(-)

Full Sequence      

MQFSSKFLALALAVLPSALADKTFVINNACPSDVPLFINAQSQGIIPHGTNVTKTLPSDF
SGLIYSTANGGSGTGRLVTSAGFHLDNGYYYIVKDDTHFNMGVEVSPHAATSNGFCPQLS
CADADCTGVFPLTQQPQSFPAPGNSPPTSPLFECPGANIGFTVTFCPTQSFPSDAHSIHP
IADRNKCLDVRGNVQANGTPVQIYDCNGSAAQSWLISPGSTKVQLADTTFCLDASPTPEN
GVGMKIWECFDNLPAQQWFLTDDNRIALENQGFCLDLTGGILTNGNQVQTWQCTDNDNNQ
AWVL

Enzyme Prediction     

No EC number prediction in KDQ31558.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	180	263	2.3e-16	0.44148936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	3.22e-20	178	302	3	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	7.09e-20	185	302	11	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.53e-13	185	304	7	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	3.79e-13	187	304	723	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	3.92e-13	220	304	2	84	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	3.52e-44	177	303	36	163
UOH83865.1|CBM13	1.03e-37	165	303	25	163
AGV14186.1|CBM13	1.11e-37	165	303	25	163
AUB23598.1|CBM13	1.11e-37	165	303	25	163
AFR93997.1|CBM13	1.11e-37	165	303	25	163

PDB Hits     

KDQ31558.1 has no PDB hit.

Swiss-Prot Hits     

KDQ31558.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999784	CS pos: 20-21. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in KDQ31558.1.