CAZyme Information: KDQ31546.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ31546.1
• CAZy Family: GH71
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157		16885.03	3.9657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:4412379-4413016(+)

Full Sequence      

MQFPSTFLALALAALPPALAAPAQINFRISPSVDTSKCLDVRGDLQANGTAVDVFDCNAT
AAQNWIIRPGTTKVQLAGTNFCLDAGSSPANGVGMKIWECFDNLPAQQWFLTADDRIALE
NQGLCLDLTNGNVTNGNQVQTWQCTDNDINQAWLLQV

Enzyme Prediction     

No EC number prediction in KDQ31546.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	32	155	6e-22	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	3.13e-18	27	155	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
411518	lectin_1	5.50e-18	29	155	714	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	3.17e-17	32	153	7	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	6.57e-13	71	157	2	86	Ricin-type beta-trefoil lectin domain.
411519	lectin_2	1.46e-12	38	153	129	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	7.61e-43	29	154	37	163
AGV14186.1|CBM13	9.35e-31	28	153	35	162
AUB23598.1|CBM13	9.35e-31	28	153	35	162
AFR93997.1|CBM13	9.35e-31	28	153	35	162
UOH83865.1|CBM13	1.04e-30	28	153	35	162

PDB Hits     

KDQ31546.1 has no PDB hit.

Swiss-Prot Hits     

KDQ31546.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000187	0.999810	CS pos: 20-21. Pr: 0.9833

TMHMM  Annotations     

There is no transmembrane helices in KDQ31546.1.