CAZyme Information: KDQ31473.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ31473.1
• CAZy Family: GH7
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
126	KL198006|CGC20	13792.48	8.2416

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:4216700-4217229(+)

Full Sequence      

IHPFGVVGKCLNVKGNVTANGTPVQIFDCNGSSGQNWSIVKGQTKVRLAGTNFCLDAGSK
PASGVALKIWTCYDNLPAQDWWFTNDSRIAVTNKGQCMDFKDGLFTNNNTVQTWKCTDNN
TNQVWS

Enzyme Prediction     

No EC number prediction in KDQ31473.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	8	126	2.1e-21	0.6223404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	9.96e-21	8	125	11	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.40e-18	1	125	3	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
411518	lectin_1	4.18e-13	8	126	721	835	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	2.75e-11	44	126	3	83	Ricin-type beta-trefoil lectin domain.
214672	RICIN	2.98e-11	8	125	7	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	1.86e-42	1	125	37	162
AGV14186.1|CBM13	7.10e-35	1	126	36	163
AUB23598.1|CBM13	7.10e-35	1	126	36	163
AFR93997.1|CBM13	7.10e-35	1	126	36	163
UOH83865.1|CBM13	7.40e-35	1	126	36	163

PDB Hits     

KDQ31473.1 has no PDB hit.

Swiss-Prot Hits     

KDQ31473.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KDQ31473.1.