CAZyme Information: KDQ31421.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ31421.1
• CAZy Family: GH7
• CAZyme Description: glycoside hydrolase family 45 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		24736.11	4.5735

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:4057070-4058123(+)

Full Sequence      

DCCKPSCAWSGKASCIADVTQPVLTCNAQGSTLTDPDVKSGCDGGSAFTCTNNSPWAVND
NLAYGFAAVSISGSTESRWCCACYELTFTSGPVAGKRMVVQATNTGGDLGSNHFDILMPG
GGVGIFNGCPAQFGSWNGGAQYGGVSSRSECSNLPSAVQAGCQWRFDWFQGADNPSISFR
EVQCPSALTSISGCSRHDGSGLPTVTAGPSTPSSSSSSAPSTPTTTTTPGGGGGGGAAQY
AQCGGIG

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	1	194	5.2e-82	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.19e-74	1	194	9	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA72362.1|CBM1|GH45	6.49e-108	1	201	34	229
EAA27871.1|CBM1|GH45|3.2.1.4	4.73e-105	1	247	33	269
CAD70529.1|CBM1|GH45|3.2.1.4	4.73e-105	1	247	33	269
AAY00851.1|GH45|3.2.1.4	2.50e-101	1	196	33	225
AOW70406.1|GH45	2.90e-99	1	203	33	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.63e-106	1	247	33	269	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	1.05e-100	1	206	12	212	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.21e-100	1	206	15	215	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1HD5_A	1.55e-95	1	205	10	210	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
1L8F_A	1.80e-95	1	201	10	205	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	4.33e-95	1	203	29	228	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	6.52e-94	1	205	10	210	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	1.94e-81	1	199	29	224	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	2.65e-57	1	194	47	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	1.14e-45	1	196	276	500	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997010	0.003010

TMHMM  Annotations     

There is no transmembrane helices in KDQ31421.1.