CAZyme Information: KDQ31399.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ31399.1
• CAZy Family: GH7
• CAZyme Description: glycoside hydrolase family 44 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		81927.46	4.4803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:3994626-3997570(+)

Full Sequence      

MLLRLRSLIAIAALFVRLSRADDLTIYTDSALASGWENWSWSSTIDFAASDVFEGTSSIS
VTSDAWAALSFKLSTGNFKDYAGLRFDISASQPALAIYFDSVTESITSPSIQLSQISQSI
TPDGFTSLLIDFNNLPGSGGQLGDSIWDRLSFQAQGDGATYHIDNIVLVESIIIEPKFLS
AEPLTNDIVAITTVGDVDFSQVAVNLNGQNVAFTTKSYSPVDAPAKSITYLTLASPFAAG
SLTITAGDLTFNYTLPAVQYGSIVQSVNYPINPHIYGVNFPPTASYINHLGVTLSRWGGN
AVTPYNPFGHFTNAGNDWYFENRASDWGSADEWVGWVSGAGSDTILTVPGLDWVAKDTTS
YSYPRTIYPDQQAFDPYNSDAGNGKFSNGSIISPPMNQSAAYTPWNASLAQRWLSSLQNI
PTILALDNEIEIAHSTHQDMHPEPVSYDEELERMVTFAKASKAALPNVAVAAPMTCSWWF
YWTSAIGWTDTEAHANTDFLPWFLQEMKKASDTAGKRLLDYLDIHYYFQPDTSANDAAAK
ALRLRMTRSLWDKTYVDESWVGESPQNHQWDPDRVQLVPRFRTLIDIHYPGTKLAISEWS
STNDQDITGGLVTADALGIFGKYKVDAATYWYQPDEMGPVGLAFWLYRGYGVYFGNKSAQ
VNLATANPDTVGVYAATENNKLSLVIINKDTKPLAYDLSNVPFGSYFLRHFGGSSGVAKW
QTTITLKANNYIVVPAYTAIFIKQQ

Enzyme Prediction     

No EC number prediction in KDQ31399.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH44	268	693	1.1e-102	0.8560311284046692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403942	Glyco_hydro_44	1.96e-82	312	529	1	233	Glycoside hydrolase family 44. This is a family of bacterial glycoside hydrolases formerly known as cellulase family J, and now known as Cel44A. It is one of the major enzymatic components of the cellulosome of Clostridium thermocellum strain F1 and of many other Firmicutes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA75148.1|GH44	0.0	8	744	4	741
CCA75149.1|GH44	0.0	11	744	8	739
SBT44864.1|CBM2|GH44	1.67e-78	238	719	15	507
AQZ62982.1|GH44	3.51e-78	241	699	18	496
AKJ63894.1|GH44	4.79e-78	270	699	44	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FW6_A	6.17e-66	257	730	14	506	Crystal structure of CelM2, a bifunctional glucanase-xylanase protein from a metagenome library [uncultured bacterium]
3II1_A	6.31e-66	257	730	14	506	Structural characterization of difunctional glucanase-xylanse CelM2 [uncultured bacterium]
2E0P_A	4.43e-49	270	739	22	509	Chain A, Endoglucanase [Acetivibrio thermocellus],2E4T_A Chain A, Endoglucanase [Acetivibrio thermocellus],2EO7_A Chain A, Endoglucanase [Acetivibrio thermocellus]
2EEX_A	1.14e-48	270	739	22	509	Chain A, Endoglucanase [Acetivibrio thermocellus],2EJ1_A Chain A, Endoglucanase [Acetivibrio thermocellus],2EQD_A Chain A, Endoglucanase [Acetivibrio thermocellus]
3IK2_A	1.28e-42	271	742	16	507	Crystal Structure of a Glycoside Hydrolase Family 44 Endoglucanase produced by Clostridium acetobutylium ATCC 824 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29719|GUNA_PAELA	1.74e-47	231	690	19	481	Endoglucanase A OS=Paenibacillus lautus OX=1401 GN=celA PE=3 SV=1
sp|P22533|MANB_CALSA	2.14e-43	271	690	801	1242	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999738	CS pos: 21-22. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in KDQ31399.1.