CAZyme Information: KDQ30763.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ30763.1
• CAZy Family: GH51
• CAZyme Description: polysaccharide lyase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711		77061.94	6.4517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:2368152-2370777(+)

Full Sequence      

MCWSYALLSDSPNRISTLGPDGKWPASEVDYTTACAARRANWPAQEHWQRIVVMAGAFHG
GLDGTSQFVKNDTFRAVISRAMDFWFSNDFTNDACIDSGGSSSCPCDTPGLWNTNWFSNT
ILIPELSSATCLLLNNTLTSTQLSNCTHITLRAYGTFTRNPTFLTGANTLDVAKVGIDQA
LLTSNVSLMTDAYSRVHRELVIQNAIKADGIRADGSFGQHAGILYNGNYGKDYTNDLLNI
EVEAAGTEFAANNASQSALSTLFDGDLWMTYRNVLSGRNFWDFAALGRFISFPVIDGQAS
AGLGMNLSRVHELGEEWGADALINFANTLSQNSSNSANGAKLNGNRMFYANDYMVHRGRN
YVTSVKMYSKRTVNTECTNTQNPLGFHLSDGVVHTYLQGNEYEDISAAWDWNLIPGITVD
YGATALSCDRTGFTGIEAFVGGASTGRIGVAAMRYSNPFTKAFHFQKAWFFFENDIQHVM
VSNISSTTTAPVFSVLDQRLHVGEVSIDSVSLRETGNITRAGAGTLWHGGVGYVFPKSNA
NTPLHIQVGNKKGNWSAIGTSTQPPPTVDLFAASLEHKDIRQAISYTVFPGIDKDAFHIK
SKTIQLRSVQNDGHISAVYDPVSDVVMSVFWDTTGGSTSFTSNSKTAPITVKSSGNVALV
FNRRTGDVTVSDPSQSLQQVTIQINTGSSTSNLVFTLPSGGLAGNSITKKI

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	346	594	3.4e-49	0.9884169884169884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	1.83e-90	345	593	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	1.90e-78	41	673	60	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	1.52e-13	39	265	55	264	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	6.91e-08	609	681	1	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96784.1|PL8_4	1.85e-231	8	711	118	818
QRV91637.1|PL8_4	2.55e-208	15	711	49	774
QRW05704.1|PL8_4	2.89e-207	15	711	49	774
QRV76810.1|PL8_4	1.64e-206	9	711	39	774
QRV76817.1|PL8_4	2.88e-203	13	710	50	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WCO_A	3.65e-12	165	676	191	714	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	4.34e-11	165	676	191	714	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
1F1S_A	1.02e-10	113	620	198	757	Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase At 2.1 Angstrom Resolution. [Streptococcus agalactiae],1I8Q_A Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Enzyme Product, Unsaturated Disaccharide Hyaluronan [Streptococcus agalactiae],1LXM_A Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q53591|HYSA_STRA3	2.50e-10	113	620	368	927	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ30763.1.