CAZyme Information: KDQ30761.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ30761.1
• CAZy Family: GH5
• CAZyme Description: polysaccharide lyase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760	KL198006|CGC11	81080.94	4.9818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:2360772-2363547(+)

Full Sequence      

MRPSSVAPVLSTLLLILPSVLHTSAADIDIVLERRLSVIVGSSTGAASIPTWISTLGPDG
KWPDVDYTTGCNAQESGWPAQSHWSRINTFSAGWHGGFPHADQWVKNAEIREAISRAMNF
WFSNDFTNSACLDSGGEDACPCGTPGFWNQNWFSNVILIPGWVGQVCTLLGDSLSADELD
SCIRITRRAFNTFSTGINHLSAGITGANALDIAGVGVDLALFTGNSTLLSEAFSRVNAEV
VIQDAVKADGIRADGSFGQHAGLLYNGNYGKNYVVDVLALEIATGGTEFGASADSMDAFS
TLIEGNQWMIFQNTLTKVLHWDFSVLGRIISLPVVDNQPTASLKINITQIQVLGQLWDSP
TITSAFSALHSPGSTVNAGALNGNRMFYANDYMVHRGPGYVTTLKMFSKRTQNSECSVSQ
NPFGFHLSDGTLYTYVQGNEYEDIFAAWDWNLIPGTTVDYDATPLSCATIRKTGTQPLVG
GASDGTVGVAAMRYETPTTKTLNWRKTWFFLEDDVQFVMIAKLNSTTTAPVFSVLDQKRR
SGDVSVDGVNRDSGNYTGVGTLWHAGVGYVFNASNPSVSLSLQLGPRTGSWSSISTSKAP
PTTVDLFAAWLTHDDLSMPISYTIYPATSTPAAFEEKVAATQLRSVRNDGSISALLDVNH
STVMIVYWTAAGGSVLIPSPTGNAPITIASNGNANLILHMDSWSITLSDPTQTLSTVTVT
LTLGSGTAPAGWGTAKTKSVTFSLPSGGLAGKSVTQTLPN

Enzyme Prediction     

EC	4.2.2.3:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	387	628	6.4e-53	0.9917695473251029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396729	Lyase_8	3.25e-87	384	629	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
238517	GAG_Lyase	1.16e-75	27	710	1	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
400444	Lyase_8_N	2.32e-15	51	331	31	285	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
397152	Lyase_8_C	3.62e-04	646	713	1	62	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96784.1|PL8_4	2.08e-238	21	758	87	818
QRV91637.1|PL8_4	3.01e-220	19	758	14	774
QRV76810.1|PL8_4	8.54e-220	25	758	20	774
QRW05704.1|PL8_4	9.69e-219	19	758	14	774
QRV76817.1|PL8_4	6.25e-213	25	756	23	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RW9_A	6.03e-19	151	712	124	705	Crystal structure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
1RWA_A	6.03e-19	151	712	124	705	Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
2WCO_A	5.57e-18	151	677	139	697	Structures of the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
6F2P_A	3.61e-17	150	713	121	699	Structure of Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
2X03_A	6.69e-17	151	677	139	697	The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]

Swiss-Prot Hits     

KDQ30761.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999677	CS pos: 25-26. Pr: 0.9592

TMHMM  Annotations     

There is no transmembrane helices in KDQ30761.1.