CAZyme Information: KDQ30612.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ30612.1
• CAZy Family: GH5
• CAZyme Description: glycoside hydrolase family 74 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
940		99216.17	7.0772

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198006:2014887-2018548(+)

Full Sequence      

MPPLPMGGEDHPSFLSVILHRCFITRTFYDRFTTNFRSSLAAVVNCIPYTYHRFAYPVPQ
YIRLAERLGIFLRCRTSITEGDERYKFWSKAKSQDTCAPSRKHHIAWKMFKLHIIAVLAA
AAISPLVHAVSSQAYTWKNVKIGGGGGFVPGIVFNPKEKGLAYARTDIGGAYRLNSDNSW
TPLLDFADDARWNYWGADALATDPVDPKRLYIATGMYTNSWDPNNGQILISTDYGASFTA
SPLPFKVGGNMPGRGMGERLAVDPHSNNILFFGARSGNGLWKSTNFGATWTKVTSFTNTG
TFIPDSSDSSGYNSDKIGIAWVTFDSTTGSSGSPTPRIFVGVASKGASNVFASTDAGATW
SAVAGQDTTFLPHKGVLSPAENALYVTYSDGAGPYDGTSGAIYKYSLTSSTWTNITPVSG
SDLYFGFGGLTVDPQKPGTVMVAALNSWWPEGQIFRSTNGGTTWTPLWAWANYPEMNKYY
TYSDSLAPWLGPNYVDGTAGNLQVGWMMEALVIDPFDSNHWLYGTGATIYGGHDLLKWDA
ATGRNVSISSLADGIEETAILGLISPPSGPTLISAVGDIQGFVHNSLTAAPAHSWTNPEW
STTSDIDFAGNAPSKLVRIGTGDSSQGKQVAFSNDAGATWAQHYGAADNVNGNKVAISAD
GTAILWRTTSNGIQISNNQATFTQVSSLPAGATIASDKKTNAVFYAANGNTFYRSGDTGA
TFTAQGTLGSSTSPRKIVVHPTVTGDVWVSTDKGLFHSTNNGASFSAISGVTQAWAIALG
APATSGGYPALFAAADIGGIGIFRSNDAGVNWVKINDAAHGFGSAASAIISGDPRTYGRV
YIGTNGRGIFYGDVAGSQPPNTATATSTATSVSSTPSSSIPVTSTRSSTTTTAPSTPTGG
TGTAPQYGQCGGNGWTGPTACPSGFTCTVGNEWYSQCIPT

Enzyme Prediction     

EC	3.2.1.151:27	3.2.1.150:4	3.2.1.151:5	3.2.1.151:27	3.2.1.150:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH74	188	298	3.5e-24	0.4592274678111588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	3.62e-15	905	938	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.02e-13	906	934	1	29	Fungal cellulose binding domain.
406353	Sortilin-Vps10	2.46e-05	179	310	12	129	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
214740	VPS10	3.48e-05	226	308	55	134	VPS10 domain.
271234	Sialidase_non-viral	4.16e-04	283	477	52	250	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDJ79827.1|CBM1|GH74	0.0	109	939	1	832
QCR98306.1|CBM1|GH74	0.0	109	940	1	840
QCR98305.1|CBM1|GH74	0.0	109	940	1	840
VWO96677.1|CBM1|GH74	0.0	109	940	1	838
BAF95189.1|CBM1|GH74|3.2.1.151	0.0	131	921	2	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGL_A	8.12e-241	132	853	3	745	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6MGJ_A	1.34e-236	132	853	3	745	Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
6P2N_A	6.44e-232	132	853	3	746	Crystal structure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]
4LGN_A	1.88e-231	131	857	3	738	The structure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]
6P2O_A	5.87e-227	133	855	1	727	Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491],6P2O_B Crystal structure of Streptomyces rapamycinicus GH74 in complex with xyloglucan fragments XLLG and XXXG [Streptomyces rapamycinicus NRRL 5491]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z9M8|XG74_HYPJQ	4.18e-296	111	938	2	838	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
sp|Q3MUH7|XG74_PAESP	6.23e-231	102	856	2	768	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
sp|A3DFA0|XG74_ACET2	2.61e-203	116	862	16	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
sp|Q70DK5|XG74_ACETH	1.04e-202	116	862	16	766	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
sp|Q8J0D2|CBHRE_GEOS1	1.08e-115	119	854	10	785	Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) OX=203496 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ30612.1.