CAZyme Information: KDQ29576.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ29576.1
• CAZy Family: GH43
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
861		98077.03	5.0211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198007:2672874-2676715(-)

Full Sequence      

MVTKEISSGWSFTQIGGGEGTKDGEWVPVSSFPTTVHVELLKLGRIPDPFVGLHEWDVQW
VGESQWAFKTTFDVSESDLSPSYVDLVFDGLDTFATVHLNGEKLLETSNQFVAYRSTAKK
LLKVGTNELLLEFANALKKGREIEKERGKLNLWNGDSSRLYVRKAQYNYGWDWGPILMTV
GPWKAIRLHTYDVSVQDVDIRSVVSPELDVNLTVTVNVLSDPSLQLSSYSMKATLKNPDG
TVRLERANVRFSDSASAQSEFHLSSSESLELWYPVGYGKQPIYSVEVEVSDLQGNVIYSE
SKKTSFRRASVVQHKLIDQDGLSFHFEINNIPIFCGGSNWIPADSFLTTMTEQRYRAWLQ
LMVDGNQNMVRVWGGGIYEADDFYNICDELGIMVWQDFMFGCGQYPAHDSFVESVREEAE
QNVKRLRHHPSVVIFAGNNEDYQIAEALKLELDYSDETSDYRKTNFPARYIYERVLPEVV
GKYSNIYYHRASPYSGQGKPTTDRTLGDIHQWNVWHGSQEPWHNWDILSGRFVSEFGMQG
YPNIRTVDHWIGEDKSERFPQSRTNCNHNKADGFERRLELYLMENFKHAFDMESYVYYTQ
IMQAETLASAYRLWRRNWQGPGREYTSGALINDCWPVTSWAIVDYFLRPKPAYFAIAREL
RPYTVGLTRKDHTTYPHDTSAAIFTISTIIEIWGTNSTLEEKKATLEVTSFDLRSDWRDK
WSEEVTLGANASTELHKGELPGQPRRTKLSEVPKTIVVSARLLDVDGSILARYSNWPEPF
KYINFPSVEEVGLKVVASADGEFVELSVSRPVKGIILDVEGEDVQWADQAIDLVPDDPQI
IGAKGLCGRNIKVRYLGDGTA

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	693	1.5e-77	0.6276595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.46e-64	30	656	32	626	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	4.76e-19	688	782	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
397119	Glyco_hydro_2_C	6.25e-04	326	488	8	178	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	0.001	67	442	112	452	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV91212.1|GH2	0.0	25	861	86	927
QRW19045.1|GH2	0.0	25	861	8	851
QRW05283.1|GH2	0.0	25	861	36	891
QRV76379.1|GH2	0.0	25	861	36	888
CCA67082.1|GH2	0.0	2	861	12	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	7.47e-141	1	835	24	802	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	6.24e-113	1	838	3	827	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	6.38e-113	1	838	3	827	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.16e-112	1	838	1	825	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	4.51e-112	1	838	3	827	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	7.21e-257	6	857	9	853	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	1.40e-226	6	858	9	845	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	1.01e-223	6	858	9	845	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	4.03e-223	6	858	9	845	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q5B7W2|MANBB_EMENI	1.07e-222	6	858	9	843	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ29576.1.