CAZyme Information: KDQ29149.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ29149.1
• CAZy Family: GH30
• CAZyme Description: glycoside hydrolase family 105 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42406.82	5.6175

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198007:1649617-1650989(-)

Full Sequence      

MSPLKVNQKASVKLTIKRIIDCLVNIKDETGEFLMTLPDGRVIDTKGWDDWEWTHGIGLY
GLLKYFEIVQDKEELDIMLRWFKERFEIGTTKNVNTMSPLLTAAYLHEAQLADYYVHLDS
WAEWVMYDMPRTEEDGLQHITYLVDNFQQLWDDTLMMTVLPLAKIGLVLKRPDYVEEAKR
QFLLHIKYLQDQQSGLWFHGWTFSGRHHFGKARWGRGNCWATIAIPEFIELLQLPKTDGL
RMFLVSSLTAQINALVNCQDQNTGLWHTILDDDSSYLEASATAGFAYGIAKAIRLRLIPK
EDRYVATVKKAMQGVLDNVSEEGELKQVSFGTPVFDDIESYKRIKLTSMPYGQSLALIAL
SEHLRTLM

Enzyme Prediction     

No EC number prediction in KDQ29149.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	365	1.4e-96	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.17e-105	23	367	8	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.61e-99	25	367	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP02596.1|GH105	1.18e-195	16	350	17	348
QRW19519.1|GH105	1.80e-183	16	366	19	369
QRV75931.1|GH105	5.77e-182	9	366	11	368
QRW04837.1|GH105	5.77e-182	9	366	11	368
QRV90741.1|GH105	6.69e-181	9	366	11	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	2.23e-142	9	365	24	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	4.06e-140	12	365	26	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	5.82e-138	10	365	6	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	2.27e-18	49	317	21	300	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	2.13e-13	174	367	225	414	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	3.32e-56	51	366	29	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.35e-07	171	306	15	155	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.35e-07	171	306	15	155	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ29149.1.