CAZyme Information: KDQ28704.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ28704.1
• CAZy Family: GH27
• CAZyme Description: glycoside hydrolase family 85 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		82871.11	4.7289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198007:522086-524720(-)

Full Sequence      

MPQIERLTRQRSDLYFRSLAELDDWYNTSSGNDDATLPYIPRSPHPEYQSSSQGKLLGGY
TETPFASSYTFNFWSRCDDFIYFAHHRISTPPPGWINAAHRQGVKMLGTIIFEGGGEADC
LKLLVGRLPASKTKSAGDQPTSLPVSPHYARLLADLAKSRGFDGYLLNFECPLQGGFEQT
RALTAWIGLLRMELKARVGEHAELIWYDSVVITGQLAWQDRLNAYNLPFFLPSTGFFTNY
TWRRDYPTDTASFFTTLDPLILANDAGSNLPKKSLNDVYMGVDVWGRGSHGGGGLGCYRA
IEHIAPESLGLSVALFGQAWTWETEQDKPGFTWEHWWAYERTLWVGPPGEEEVKVPEAPR
RQGEDECLHGPFVPLNNFFTRKAPPNPAKLAFHTTFSPGVGRAWFVNGEKKSSQPTGWTD
IDKQCSIGDMVWPKPEFEDNWNGAPTALAELCMEDAWNGGSSLRLIVSTHASDADDAFFR
QASVPIQSLSITPGAVYQLVAIYKIEESDGLELDACLSCQLIHGGDRSVQITPDDISPVE
LAGGWIRLSARISSEELPSFVHDDLASVGLTISIATDNPSRASRFSLLIGEMTVYPFRPP
TAAKVPQVLWADYKPLPASTGKAGQLSWEVAVSFATENISLPLSPDVPIPVWNFEPAKAW
KPSFLYFNIYVQEPIQTGGNNFAPPESAKWIGTSGWDGKRDTFPVDADNLSIAAQGESAR
LVRFYVQGVTDHGEVLPWDACVYVETEI

Enzyme Prediction     

No EC number prediction in KDQ28704.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	67	405	1.1e-61	0.9428571428571428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	3.24e-90	66	401	5	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	8.69e-77	58	424	8	325	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	3.37e-32	68	465	101	446	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWP00370.1|GH85	2.69e-203	15	748	18	734
CDR49555.1|GH85	5.19e-63	15	645	18	659
VWO96094.1|GH85	1.06e-62	261	419	6	165
SAM80897.1|GH85	2.02e-61	15	694	51	799
CBQ71989.1|GH85	3.94e-61	15	694	45	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	1.46e-15	70	486	80	440	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.46e-15	70	486	80	440	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2W91_A	2.68e-15	68	464	82	426	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
2VTF_A	3.39e-15	70	486	85	445	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3GDB_A	3.53e-15	68	464	233	577	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JZC2|ENAS1_ARATH	2.81e-41	56	463	71	405	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	2.31e-37	74	344	100	334	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	5.37e-35	8	553	79	572	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	6.87e-35	8	513	71	501	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|P0C7A1|ENASE_CHICK	1.19e-34	8	465	77	459	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ28704.1.