CAZyme Information: KDQ28003.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ28003.1
• CAZy Family: GH17
• CAZyme Description: glycoside hydrolase family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	KL198008|CGC18	57464.51	7.5988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198008:2090798-2092924(+)

Full Sequence      

MSTAAFQVTITNHTTTSHPSPHILYVVKVNTEQGQYQVLRRFSEFYELHLSLGDQYNFPP
KRSVSNSLLPRAWVDDELIAERKHGLQDYMTNVLGDSKFTGNAAITMFLSDDDVGGHPEM
SSLRHIVLSGEETKGAEGKKPIAAAYYTSWSAWSNPPSKIDFSKFDVLFYAFVVPNSSST
ISWDSGSQDTLRTLVSSARKSGKGTKIVLSIGGWAGSYWFSNSMSNNDNRQRLANELIGA
VDSFGLDGIDIDWEYPNSEGSGNPHSSKDATNLLTFVKILRSRMGWSKIISAAVPHQPWL
GPDGRPMRNVSDFAAQMTYVNIMNYDVSGGTAPPGPNAPLGNACNKAKLANANAQVALGF
WTAAGFPANKLLLGLPLYGYVIRSSATKMSASLADNVEHMGKHLIPGTYKHEEGDSDIAP
AGDLTHLYGQQIGFNQLVSMRALKKQKDGSYVGDNGYKRGWDNCSSTPFLFNTAKNTFVS
YDDPPSLAMKAQFAKQKGFGGCFTWSLDQDDGVALQNAIRKDLGLK

Enzyme Prediction     

No EC number prediction in KDQ28003.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	144	513	9.8e-64	0.9358108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	7.52e-58	144	510	3	334	Glyco_18 domain.
395573	Glyco_hydro_18	1.20e-51	144	510	3	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.75e-46	144	510	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	5.02e-44	140	526	37	439	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119349	GH18_chitinase-like	9.18e-40	144	363	2	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV73087.1|GH18	1.43e-90	140	526	121	507
QRV87962.1|GH18	2.01e-90	140	526	121	507
QRW02133.1|GH18	5.07e-90	140	526	155	541
KGB76962.3|GH18	5.86e-83	146	525	456	831
ADV24093.1|GH18	1.10e-82	146	525	454	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	8.69e-45	144	520	5	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6KST_A	3.28e-38	135	523	1	370	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.64e-37	135	523	1	370	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	2.94e-36	135	523	1	370	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1ITX_A	1.96e-30	206	523	124	419	Chain A, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	8.36e-29	206	523	156	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	3.94e-28	146	511	27	364	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P36362|CHIT_MANSE	2.22e-26	197	511	88	376	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q6RY07|CHIA_RAT	3.95e-26	146	511	27	366	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|A5FB63|CHIA_FLAJ1	1.16e-25	136	519	22	455	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ28003.1.