CAZyme Information: KDQ27992.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ27992.1
• CAZy Family: GH162
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	KL198008|CGC10	33118.97	5.7473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198008:2062363-2063644(+)

Full Sequence      

MRLFQCLPLLSAYGVFGSRIYNIVNNCPLSINLFINGQSEGSLASYGGTTSRTVSDTWSG
FIYTDFNRGNQDGAGTVRAGFFGDSNYYYIVKDVNWLNVGVSIAPIDRAPKGGLCLHATC
EVFNCPDAFSQPPTAFPPPQSGVPPQTPLYECPQAGTGYTVTFCPSGEIPNYQTGPNHIS
TYRSVNKCLDVPYLGNGAPVRIYDCSSPNGGIQRWAIKRGGQQIKLSGTTYCLDAGSSPA
SGVGAKIWTCYDNLPAQQWTYTPDDYIRLTGTSQCLDLTDGDLTNGRQAQTWECAGNNQN
QLWRI

Enzyme Prediction     

No EC number prediction in KDQ27992.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	185	304	1.1e-21	0.6276595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	1.89e-23	186	305	10	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	6.64e-22	186	303	11	126	Ricin-type beta-trefoil lectin domain.
214672	RICIN	4.84e-16	186	305	7	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
395527	Ricin_B_lectin	7.28e-15	223	305	4	84	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.30e-13	181	259	47	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACN56442.1|CBM13	1.54e-37	169	303	26	162
CED83142.1|CBM13	1.36e-20	188	305	209	328
AGV14186.1|CBM13	5.24e-19	186	303	43	162
AUB23598.1|CBM13	5.24e-19	186	303	43	162
AFR93997.1|CBM13	5.24e-19	186	303	43	162

PDB Hits     

KDQ27992.1 has no PDB hit.

Swiss-Prot Hits     

KDQ27992.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.684440	0.315565

TMHMM  Annotations     

There is no transmembrane helices in KDQ27992.1.