CAZyme Information: KDQ27872.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ27872.1
• CAZy Family: GH16
• CAZyme Description: glycosyltransferase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44595.55	8.9990

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198008:1746457-1747693(-)

Full Sequence      

MPFELVLLSGAAHLLTAAFAYACHTAVVLFDSSPTVAAIDSPFFRWDAFHFAHIADHGYV
YEYEWAFFPGVPSVLRILSSSSGSDHLSFLFHALALLPISMFSALTLYELSSLVLGSPKL
ARLATLLSLLPSSPITLRLAPSPEGWYTCAAYRGMLHCARKEWLRAALWFMIAGSFRSNG
IVLAGFILWGMLVEPFLLQKKISLANLWKSIPLVGMVFAPFIYHHCNAYLAFCLSADISA
PEWCSRTIPSIYSYVQAKYWNVGLFKYWTLQQLPNFILPAPVLLILFSFSFWYLRNLCPD
RRAVERRPSSPSSSNFLTLKLVPHVIHTCFMGVTLLVASHTQIALRLAASMPTIYWAAAW
LHCHKPTHSLARLWVWWSFLWGSISIILWTAFLPPA

Enzyme Prediction     

No EC number prediction in KDQ27872.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	35	396	3.8e-81	0.8894348894348895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.50e-34	46	396	60	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.68e-15	39	291	66	317	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA72745.1|GT76	3.58e-78	14	396	21	430
QRV77141.1|GT76	2.25e-52	39	396	92	535
QRW06081.1|GT76	2.25e-52	39	396	92	535
QRV91959.1|GT76	4.45e-50	39	396	91	534
CDU22455.1|GT76	1.81e-43	43	396	100	479

PDB Hits     

KDQ27872.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TPN3|PIGV_MOUSE	9.21e-37	45	361	65	420	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|P0CP62|GPI18_CRYNJ	2.23e-36	26	396	31	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	6.27e-36	45	361	65	420	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|P0CP63|GPI18_CRYNB	8.19e-36	26	396	31	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|Q9NUD9|PIGV_HUMAN	2.55e-32	45	361	65	420	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984535	0.015503

TMHMM  Annotations     

Start	End
7	29
93	115
167	189
273	295
316	338
343	360
373	392