CAZyme Information: KDQ27856.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ27856.1
• CAZy Family: GH16
• CAZyme Description: glycosyltransferase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1114	KL198008|CGC12	122249.18	8.2070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198008:1699196-1702743(-)

Full Sequence      

MALRFQTNYDFTDVPIPTTSARQPPTSAPTIRRAKTLTRPERSVAPVPLIAPSHASGLHA
SGSSSSIDEYGGSSVWKVFSRIVTFWAPGVLLSSLGGLKDKATQQAWREKMALCFIIALL
CGAVGFATVGFQKVLCPQNNDTDSRFVRLGSRAGTLGIQGHLVNVSSARSTDDVSFTNLA
LSPGRDITNLFTRDANNFPSCNGLSFRIAVDPPCSTRTPCPLGNLNSSSTITSLGIVDTG
LLVGYAWEQVANFTNYFVLDGAVLNLDPYMRTHTSPIPGDNVDTALRTLMRTQAADSGKD
GTLLFSSRADLKSAVPCLKERYYAGNIDKVTPGCFVSQLFLYTGLFVIMALVLVRFAMAC
VFNWFLSAKLAGPPNSSELNRSAISPAVMPEGANLSVDNKNGTAPWASSKKPKASKVPRS
IASASSTTLTSDGGAAPIMSLAQIGAELFAVCLVTCYSEGEDSLRTTLDSISTTTYSDAR
KLLFIVADGMITGAGEKRSTPDICVGLLEADPRFGNPIPMVYAAVGTGSKAQNRAMVYAG
HYTVAGRRTPTVIVVKCGTEQEAASDKKPGNRGKRDSQLILMNFFSRVTYNDRMSPLDFD
LFRKIHILMGVTPDFFEVCLMVDADTKVFPDSLGYLVNCMHHDQMIMGCCGETRIANKRQ
SWVTAIQVFEYFISHHLAKAFESVFGGARRTNGDDWVPLIVKPEIVKEYSQCEVSTLHQK
NLLLLGEDRFLTTILIRTFPNRKMMFLPQARCRTVVPDTFSVLLSQRRRWINSTIHNLME
LVLVRNLCGIFCFSMQFVVFMDLLGTVVLPIAITLTYALIVGMALDPPKSFEEAIPLVLL
IAVLGLPAILILITTRKVVYVFWMLIYLLALPIWNFVLPVYAFWHFDDFSWGETRKVEGE
TKGEAHGEGDGQVATSVPMRRWEDWERSRLRKLRRDERRRRDFERQHGGYVTGDLLSARM
GSQYEGSDTVSVTSSEDDQWGPQIGGYNEQDVKYPPPPTGLFVPHDMLSSAKTVDKSELE
AMLNAGFDDRPSPPTSTYAPRYQSSVDGSTTQLPRIAGNGYTPMSRSASPGVAPHPAEVA
TPISPNTHMHGHPMRQRPSEPYGPLGPLDPSTRF

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	436	927	1.1e-231	0.9753320683111955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	426	927	2	526	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	3.86e-74	452	777	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	5.64e-20	617	883	139	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	5.97e-13	453	687	2	150	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	2.64e-06	620	825	3	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYK92508.1|GT2	0.0	1	1114	1	1124
AZQ26802.1|GT2	0.0	9	1114	7	1140
QDK64615.1|GT2	0.0	9	1114	7	1140
QRW21320.1|GT2	0.0	14	1110	694	1767
QRV93872.1|GT2	0.0	2	1111	5	1109

PDB Hits     

KDQ27856.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4P333|CHS7_USTMA	0.0	13	1047	23	1093	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1
sp|O13356|CHS1_CRYNH	0.0	76	1076	75	1118	Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS1 PE=2 SV=2
sp|Q01285|CHS4_NEUCR	5.82e-193	74	929	209	1190	Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-4 PE=3 SV=3
sp|P78611|CHSD_EMENI	1.04e-188	74	929	185	1168	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|O13353|CHS4_MAGO7	2.06e-186	74	929	205	1185	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

Start	End
111	130
344	366
803	825
835	854
861	883