CAZyme Information: KDQ26971.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ26971.1
• CAZy Family: GH105
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A067NTM8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	KL198009|CGC2	96149.59	6.6830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198009:2030102-2033408(-)

Full Sequence      

MNFRRDDKKSFSSIDQAASTFRTFPYNDPSLAAFETAVIGLNPEVAIKLRSATVQAAVLT
LRPNQNSLFIDAEFRIQVIDTVAELPHVEKGQGAAFVRDERALVVWSDRTDDIIDSAKEF
EQRLLALVWGRHSSTRPSSLAPSMSSSPRIGPVGLPPTPGAPGTPVVAGHSHTPSLAASS
SIGGIPPLDLNEKSDGNLAEKGMADEQIDPKRDLRPLRVYGPIYDGLAVGLAFFFVGTGV
RTLLAEYTLDKDATRFALLVTAPLFFFVSLFFCITLIGSISQVIGPVAQCHENSRYYSAI
PPPPPRIDPNNPDSHALPHVTIQMPVYKESLNETIAPSVYSLQKAMVTYARQGGTSSIFI
CDDGMQLLSDEDRILRQAFYAKHRIGWVSRPGHSNEKDGFKRAGRFKKASNMNFCLKIAE
RMEEIIKEMLLEEARASSPPPLPTADLEEKALQRACAETNGQAWAAGGRSLRLGEIILLV
DSDTQVPEDCLRDAARELAISQEVAIIQHESDAMQVANHYFENAIAYFTRRVNKSITMAC
ANGEIAPFVGHNAFLRWSAMKEAAFVDKDGQRKYWSEEHVSEDFDMAMRVQLRGYIVRWA
TYSNKGFKEGVSLSADDELNRWTKYSYGCNELLLNPIYTWPWKGPFAPQIRRFLWSSAPI
HYKISMLAYMFSYYGIASALSMGVLNYILLGMQFHIDNFYMRGFELWLACFVLFLGAGNI
SFTIMEYRLGNRSILESLFENIKWLPFFFIFFGGLSVHLSIAILSHLFSINITWGATKKE
VERSNFFEEVPKILKRFWFVLTLCTCIIAGMVILSTNLVPAEWQVTGEAWAVILPLALSV
ACHVLYPIVLNPWLMIFSY

Enzyme Prediction     

No EC number prediction in KDQ26971.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	476	681	2.7e-55	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.22e-50	476	690	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	3.73e-11	474	784	138	429	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.08e-06	430	583	43	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133057	CESA_NdvC_like	1.23e-04	428	611	52	209	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA68526.1|GT0	0.0	21	859	43	871
VWP01253.1|GT0	3.98e-313	21	837	43	856
BAC77594.1|GT0	1.62e-307	21	859	80	927
CCA73139.1|GT0	1.51e-299	14	859	43	924
CCA70385.1|GT0	9.53e-297	14	859	40	919

PDB Hits     

KDQ26971.1 has no PDB hit.

Swiss-Prot Hits     

KDQ26971.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999931	0.000101

TMHMM  Annotations     

Start	End
222	244
256	278
668	690
703	725
747	769
797	819
829	851