CAZyme Information: KDQ26651.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ26651.1
• CAZy Family: GH1
• CAZyme Description: glycoside hydrolase family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		23907.81	4.6436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198009:1104531-1110247(-)

Full Sequence      

MVSAFGATDAPTSVGLDPVATANTMAAWVKQYGLDGIDVDYEDFNAINAGDGKAEAWLTS
FTKQLRVQLPQGTYILTHAPVAPWFSPNKFGGGAYVTINKAVGHLIDWYNLQVCTPLSSA
YPQTNFSYGTSEYTTCDGLLSTSSSTWPNSALFQIAASGIPLSKLVIGKPATTGDASNGF
MSTATLAGCLQQAKGRGWNAGVMVWEFPDAAASWIRDVRSQAFPE

Enzyme Prediction     

No EC number prediction in KDQ26651.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	19	199	2.1e-16	0.5135135135135135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	1.71e-19	1	126	68	193	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	7.94e-11	22	205	99	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	3.70e-09	24	210	103	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
395573	Glyco_hydro_18	2.55e-08	22	179	93	230	Glycosyl hydrolases family 18.
226000	Chi1	9.91e-07	20	205	121	302	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96832.1|GH18	5.01e-92	1	224	112	327
BAH80442.1|GH18	2.22e-86	1	224	39	253
VWP01452.1|GH18	4.94e-84	1	223	51	260
VWO96830.1|GH18	4.65e-83	1	225	108	342
VWO97811.1|GH18	2.85e-82	1	223	109	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	2.99e-18	13	218	88	274	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]

Swiss-Prot Hits     

KDQ26651.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000018

TMHMM  Annotations     

There is no transmembrane helices in KDQ26651.1.