CAZyme Information: KDQ26031.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ26031.1
• CAZy Family: CE16
• CAZyme Description: glycoside hydrolase family 37 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		84656.94	4.9285

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198010:2547859-2551206(+)

Full Sequence      

MLTSLAATLVALTTHGALAQTSSATAPGQSVTSLSLPISTAVASPTASSGASLPSQVQLP
PRQAWCPGEIFCAGELLQTVNLAGLFPDAKTFVDKPTSKRSQEVLNEFANLSSTPTFGEI
TNFVNDAFRGEGLELQALTLPGFKDSPAFLNNVTNPVVRSWTQIVHTYWNSLTRGTNETQ
ICGQGPSATCESSLIPLNHTFVVPGGRFREQYYWDSFWIVEGLIESELFEVVNATLQNFM
DEIETIGFIPNGGRTYYLNRSQPPVFIHMLERYITASGDTSILARALPLAERELTWWQEN
RSVNVTSPTTGRIHTMSHYNVNNTAPRPESYIVDYITANTPELPALNESQRANLYAELAS
GAETGWDYTARWLREPNTHGDAGLRTLNVRGTIAIDLNSILYQAHTILADLYSQADTAAA
TRHRTAATNLREGILDLCWNATKLAFYDFNLTSNTQSDFFSAAHFYPLWAGIIPDDLLRS
PENAFGAFSTVNMVMNRYNGTYPSTFLDTGLQWDAPNAWPPHQYIILQALRNLPSNLTSG
AIASPASDQSSFTLVPRGQIGLEENQLPGQPLHEQTNQTQNATLTGAQADLNRLDGSVVN
GGNATQGEGWAQILQRELANRYITSAFCSWRATGGEVPGLVPRLSDAELNVTQSLTNTGN
MFEKFSNLDIDSAGRGGEYVVQAGFGWTNGVALWVASHYGNVLNAPQCPNLLEGASATIR
DRLIVLLFLICLAFLIHRIRVPTCIPAQTITTAFAEASNSNLRVSPVSPLHFPLSL

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	85	537	6.2e-124	0.8737270875763747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	3.79e-117	85	700	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.03e-96	71	700	13	545	alpha,alpha-trehalase
224541	TreA	9.59e-70	74	532	59	485	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	4.07e-65	21	531	1	469	alpha,alpha-trehalase TreA.
237326	treA	1.81e-63	33	532	11	470	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI56844.1|GH37	0.0	1	718	1	718
QRW20035.1|GH37	9.52e-250	96	712	112	736
QRV92208.1|GH37	7.68e-249	96	719	112	743
QRV77412.1|GH37	1.54e-248	96	719	112	743
QRW06352.1|GH37	1.54e-248	96	719	112	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	2.11e-59	76	532	17	436	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	9.83e-58	76	532	17	436	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	8.46e-57	76	532	54	473	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
7E9U_A	3.70e-53	87	700	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.55e-52	87	700	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19813|TREA_RABIT	6.85e-95	76	713	38	563	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	3.27e-91	76	708	59	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|O43280|TREA_HUMAN	2.05e-87	76	705	38	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	1.88e-84	76	705	35	553	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	1.77e-82	76	705	51	574	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000410	0.999555	CS pos: 19-20. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in KDQ26031.1.