CAZyme Information: KDQ25884.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ25884.1
• CAZy Family: CBM67|CBM67
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	KL198010|CGC8	68285.14	4.7402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198010:2087415-2089708(-)

Full Sequence      

MNNNSSNYYANANYTQQLPSRTPSRTPSRTPSSGSRKVRTGRGAIAHGVASGQIGGGYGP
YSYTPAPSANSGVYTASRFSAPPSDATIAHNAGEKQTILPTTTTVPQYLWDRDPDVDDDL
HNPDPARDARENRSFTIFSGRGWLNAIAIFVLVTGLIVLFAGYPIISYVNKSTFAPGGFN
IGGINGTGQIPVLPGLPKLIDDDTPQNVRSRTGSDGKRYNLVFSDEFNTDGRTFYPGDDP
FWEAVDLHYWPTGDLEWYDPSAITTEDGKLVITMSQKPSHDLNFESGMLQSWNKFCFTTG
YIEVSMSMPGSPKAPGLWPAAWTLGNLGRAGYGATTEGTWPYSYAACDVGTFPNQTAKDG
TPEAAATGSTGNTELSFLPGQRLSACTCPGSDHPGPRTDVGRAAPEIDIIETQIDTNLWR
GEVSQTFQVAPFNYKYAFDNTEPASVIHGSNTHYNSYAGGEFQQAVSALSYIDDQFYNNT
AYAPYAFEYWSNPNRRDEGYITWYSNGEQTWTATAAATGPDPVSQVSARIIPEEPMYIIL
NLGLAPNFQKQDFKNLQFPSKMYVDYVRVYQRDDVKNGVTCNPPSRPTADYIDNHINAFS
NPNLTTWKDAGYTFPRNSLYDGC

Enzyme Prediction     

No EC number prediction in KDQ25884.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	225	570	1.8e-141	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	120	623	14	500	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	4.02e-149	221	571	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	6.49e-44	199	585	29	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	8.95e-28	223	570	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	1.85e-07	225	570	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15086.1|GH16_2	1.53e-242	42	623	78	681
QRV86526.1|GH16_2	1.53e-242	42	623	78	681
QRW00570.1|GH16_2	2.09e-242	42	623	78	681
CCA67817.1|GH16_2	1.71e-235	48	623	59	637
QRW27364.1|GH16_2	1.27e-233	49	623	81	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CRQ_A	7.21e-08	219	326	3	103	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	1.08e-07	217	577	2	238	Structure of Marine bacterial laminarinase [Aquimarina]
6JHJ_A	4.73e-07	217	577	2	238	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
2HYK_A	3.76e-06	218	571	6	243	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4DFS_A	5.97e-06	219	332	18	135	Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13941|YEPB_SCHPO	2.85e-137	94	623	110	627	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P32486|KRE6_YEAST	1.76e-134	117	623	219	711	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	1.04e-129	117	623	259	763	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13789|YEOB_SCHPO	1.18e-121	113	623	140	636	Uncharacterized beta-glucan synthesis-associated protein C17G6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G6.11c PE=3 SV=1
sp|P87024|SKN1_CANAX	1.86e-120	106	623	239	737	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
143	165