CAZyme Information: KDQ25709.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ25709.1
• CAZy Family: CBM67|CBM67
• CAZyme Description: glycoside hydrolase family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1033		113016.74	6.5931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198010:1624008-1628179(-)

Full Sequence      

MDVHLPAKGRSRRAWPILFLLAFLAIVFTRGTSFSRAPSDNANHPLGIAPRSLPHQVRFD
NYSLFVGDQRVFIHSGEFHTFRLPVPSLWPDILQKAKAGGLNAVSVYTHMGLINPSPGVV
DFGGFRALQPLFDAAKDAGIFVVLRPGPYINAETTAGGIAHWATSEVAGNLRTGDADWKA
AWQAYIQGIIEVTVPNQITEGGPVIGEFSRAQALLDNEFQQAPEGHAQYFVDLEEAYRAS
SIVVPLTYNDPGEGRNFINGTGAVDLYGVDAYPQRYDCSHPTVWHDVPTGYPQYHAEVNP
SQPWYIPEFQGGSFDAWGPTSPGYAPCRTLTGADFQSVFNLQLWASNAKLINYYMFYGGT
SWGAIPFHGVYTSYDYGASLQESRQLTSKFDELKRQGLFLRSSPEFYKTDWVGDTSTGAT
STTSTAAFATLLRNPDTNARFYILRQADVTSTAAINFKLNVSTSAGNIQVPRVASAITLG
GRQSKVVVTDYAFGSSRLLYSTAQVFFAGTIDGRDVLFLFGDSAQEHELDLTLSGTPRGS
RPPSSTVRFTTSLSSSRMTVSFLPGIEGPVTVWDSDKQLVLFSDTATAATFWAPTIAGKA
SDPLKNFWQIGTNTTILVGGPHLVRSASISGSRLDLKGDLSESVRLSVIAPSNVRSITWN
GERVDVDVRMSSQLSFRGAFVSTLKATTREIKIPKLGKWKFSDSLPEIRAGFSDQKWAVA
DHTSTNIPYKPYYGDGRILYGCDYGFCENIVLWRGHFNATGDEKSVNLSINGGEAFAASV
WLNHVFLNTSYGNSTNNQNILEETDDRFTFPPGALFRGDNVLTIVQDNMGLNESRGGEYS
SKGPRGVRGFQLDTGNFTEWRVQGKVGGYTNFLDKVRGIMNEGGLFGERQGWHLPGFDTS
SWKARDLASGLPGSAAGVGFFVTTFNLNIPKGFDAFLSFTFNEPLGQPYRALLFVNGWHM
GKRVGNLGPQAKFPVHEGILDYRGRNTIAVALWTMESDVPISPDFQLTLDGVVEGGVGDV
KVNNPVWSPEGRV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	64	395	6.8e-71	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	9.40e-69	63	395	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	2.08e-41	432	560	24	150	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	2.50e-35	432	591	25	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	1.38e-34	886	998	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
166698	PLN03059	6.51e-25	57	382	30	323	beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV86584.1|GH35	0.0	47	1033	31	1007
QRW00634.1|GH35	0.0	47	1033	31	1007
QRW27580.1|GH35	0.0	48	1033	23	1005
QRW15140.1|GH35	0.0	47	1033	31	1007
QRW10069.1|GH35	0.0	1	1016	10	1072

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	1.30e-188	53	1027	2	964	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
4IUG_A	1.13e-185	44	1021	33	991	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
5IFP_A	1.53e-184	53	1027	42	1000	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	4.25e-184	53	1027	42	1000	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
3OG2_A	2.66e-178	46	997	15	965	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D1Z9|BGALA_NEOFI	2.13e-189	53	1007	42	978	Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacA PE=3 SV=1
sp|B0XNY2|BGALB_ASPFC	3.86e-189	34	1030	17	1010	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1
sp|Q4WRD3|BGALB_ASPFU	3.86e-189	34	1030	17	1010	Probable beta-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacB PE=3 SV=1
sp|A1D199|BGALB_NEOFI	7.65e-189	34	1030	17	1010	Probable beta-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacB PE=3 SV=1
sp|Q4WS33|BGALA_ASPFU	6.47e-188	53	1007	42	978	Probable beta-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.043086	0.956892	CS pos: 31-32. Pr: 0.9229

TMHMM  Annotations     

Start	End
13	32