CAZyme Information: KDQ25617.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ25617.1
• CAZy Family: CBM21
• CAZyme Description: glycoside hydrolase family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		72644.12	5.0897

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198010:1385180-1387566(+)

Full Sequence      

MRRTIACLAAILSCAPLTYGRAPFGPWDTFNYAPPSKTVFPRSIRSIVGDVSQAGHLVTH
GKGGATFHGNGSYVVLDWLQEYGGRLSLHIDKATPQSALSLSFSESPQFISPLRSDDSCH
SIPTMDGDGVQSLPQPLTAGRFTQTIGQQRGGFRYLTIVSNSDAPVTISDISLSITFMPH
FDDLRDYSGYFSAEDPSFHDKDFLTKLWYAGAYTVQTNTFDVNEARQQPCPAQGWANNAS
AGPVEGPVLVDGAKRDRNIWPGDMGISTHTEFVSTNDMLPTKNSLLVMFSTQDPATGALQ
YSGPPINAHGSATYIAWSLIGTHSYFLYTGDLDLVKTVWANYTKALDFLQSHVDELGLMN
VPVEFQNDWGRDGGAGHNSAMNALLYQTLVTGADLASHLGDEQLSASFLQNSTAIKAAFN
RVLWDSEAGMFRDNETSTLFPQDGNSLAVLYNVTETEEQNQAISSGLTQFWTDIGPVSPE
LDDTIIPFVGGFEVQAHFVAGQGERGLDLLRKEWGYMLYTNLSVQSTLLEGFTKNGSLGY
RSAAGYNFDHSYTSHAHGWATGPTPALTFFILGLTITSPKGATWSVAPVLGDLKAAEGGF
ETALGWFGVKWTLRNRVFVLQISTPRGTNGRVRLPGLGKVEFNGVMHDGLQEMRLDGGDH
TFTQNLGN

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	72	634	2.2e-76	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	4.76e-08	381	463	330	407	alpha,alpha-trehalase
183934	treF	1.11e-06	381	433	351	403	alpha,alpha-trehalase TreF.
395961	Trehalase	2.42e-06	381	482	307	389	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
407469	Bac_rhamnosid6H	5.12e-06	248	518	31	301	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.05e-05	583	645	11	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK57529.1|GH78	2.91e-159	25	649	44	657
QRD88907.1|GH78	1.16e-158	25	649	44	657
ATZ56650.1|GH78	4.20e-158	25	635	41	639
QSZ36009.1|GH78	1.73e-157	25	635	42	640
APA15545.1|GH78	1.33e-156	25	635	41	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.70e-15	153	605	273	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KDQ25617.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999717	CS pos: 20-21. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in KDQ25617.1.