CAZyme Information: KDQ25248.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ25248.1
• CAZy Family: CBM13
• CAZyme Description: glycoside hydrolase family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	KL198010|CGC1	82277.57	6.3893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198010:324462-327667(+)

Full Sequence      

MWLSSLLVGLLAANKVVGQSTVDESAQYVMPVGSPGFYNGHSNASVTFDQHSVLLDGKRV
MVFSGEFHPFRLPAPELWKDVLEKFKAAGFNAVSVYWHWGLTSPREGEIRFTEHNDAQKF
YQVAKDVGLLVIVRPGPYVNAETAGGGLPGWTTNVPGLARTNATLYRSAWHPYILSFAQQ
TAPFQYPDGPVIAIQSENEYATTAQQHIPGLDEHMQDIIDTMREGGLTRIPTIHNDKNPS
GQYAQPGLGKVDLYGWDGYPLGFDCDNPSRWTELSTAHDTNHQRWNPAEPLALYEWQGGS
FSYWSGPDYSLCYQLINEQFANVYYKNNYAAGVAIQNLWDELGQFTYPHNIFELRVVMAP
YVISLNIALGLTAPTPARQALREDRTLSPKLDELKLQASFLHASPDYLLVGRIGNGTVGQ
GTAYSDSPDIYTTHLHAPQNDVNFYFVRQKTNTETSDTPFTLRVNTTLEGTISIPKSGSI
VLAGRESKILVTNYPFGSSVLHYSTAEVMTWATLDGVDIIVLYALEGQHVEIAVVAPGKA
KVTIAGSKSISAATTNGLITLSGSASGISVATFNNKRIIVADKKSASGFWAPRLSTSSAD
GVSHYAPTPDVPSVLVHGPYLVRSATKRGRTLALTGDLNATTTIQVFAGADVRSVSWNGA
PVNVRRSELGSLQGVLSFPRSLSTVEIPNLQNIQWRCADSLPELEPNFDDTDWVVANKTS
TTRPQQPTAGKFVLYSSAPVAGGLIHHNTILALL

Enzyme Prediction     

No EC number prediction in KDQ25248.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	54	338	3.7e-60	0.8338762214983714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.17e-68	52	338	1	267	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	6.79e-54	416	586	5	178	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	4.62e-35	418	586	8	179	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	8.46e-25	41	200	25	187	beta-galactosidase; Provisional
404273	BetaGal_dom3	1.09e-24	609	673	1	65	Beta-galactosidase, domain 3. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX07308.1|GH35	2.47e-265	7	736	12	794
CCA67251.1|GH35	8.33e-241	28	735	54	765
CCA67250.1|GH35	2.91e-238	28	735	69	779
QRW20525.1|GH35	1.54e-222	1	736	1	711
QRW07021.1|GH35	5.21e-218	1	736	59	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OG2_A	4.83e-120	46	737	26	704	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFP_A	6.77e-116	46	737	46	719	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.84e-115	46	737	46	719	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
1TG7_A	2.42e-111	46	729	6	678	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
4IUG_A	2.48e-110	46	737	46	719	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D1Z9|BGALA_NEOFI	2.03e-117	46	737	46	719	Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacA PE=3 SV=1
sp|Q4WS33|BGALA_ASPFU	2.84e-117	46	737	46	719	Probable beta-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacA PE=3 SV=2
sp|B0XMP7|BGALA_ASPFC	1.51e-116	46	737	46	719	Probable beta-galactosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacA PE=3 SV=2
sp|A2QAN3|BGALA_ASPNC	3.09e-115	46	737	46	719	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|P29853|BGAL_ASPNG	5.90e-115	46	737	46	719	Beta-galactosidase OS=Aspergillus niger OX=5061 GN=lacA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999718	CS pos: 18-19. Pr: 0.9795

TMHMM  Annotations     

There is no transmembrane helices in KDQ25248.1.