CAZyme Information: KDQ24799.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ24799.1
• CAZy Family: AA9
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		44562.19	4.5803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198011:1777902-1779637(-)

Full Sequence      

MESFLLSLGLAALLLSGAVAQKPAYLGALLIEPGVNNGKCLTAASNNDGAVVTIQGCTGA
DAQKWTFDGGSVKVFGNKCLDVTDGSTADGVKLQIWTCNVPNANQQFFYTSDYHLAWTDH
GKCMDLTDGNQSDGNRIQLWACSGTNPNQVWNTGYMANALPQTSESGQSGTNNCGTGSSQ
TSQCQTAWINDVDDFCLWAPPNPGSTIGDTEREEVAWCTKSGRGARTMPAGTLTGVHFVK
TPDYVQVTGVGDFTKINIRRGDQGGELDPHGADGNGNPIGGLVFGNTFGAARQYHEWTSF
ISDTEFCFRACIGPNAARNCQHIYDVMGCFWNMPANYDAGTFESCDADDDLPMGVYGTST
WFQGVNPTPPAHPAASSSNCRTIPTVTASPARRRRDNGAFEREFSGRDAFGVFPTPAP

Enzyme Prediction     

No EC number prediction in KDQ24799.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	35	160	4.2e-24	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	1.86e-23	36	153	8	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	5.45e-23	34	151	7	126	Ricin-type beta-trefoil lectin domain.
411518	lectin_1	9.87e-18	20	153	694	836	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
214672	RICIN	1.31e-15	34	153	3	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
404972	RicinB_lectin_2	1.63e-13	61	140	1	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV77601.1|CBM13	4.70e-178	23	403	21	401
QRW06545.1|CBM13	4.70e-178	23	403	21	401
QRV92416.1|CBM13	9.47e-178	23	403	21	401
CCA67406.1|CBM13	3.71e-149	20	386	17	386
CCA67412.1|CBM13	6.29e-146	12	386	10	385

PDB Hits     

KDQ24799.1 has no PDB hit.

Swiss-Prot Hits     

KDQ24799.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999743	CS pos: 20-21. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in KDQ24799.1.