CAZyme Information: KDQ24797.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ24797.1
• CAZy Family: PL8
• CAZyme Description: carbohydrate-binding module family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	KL198011|CGC7	35876.68	4.8587

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198011:1772524-1773989(-)

Full Sequence      

MPPVETQRTEHKCKYGPANLTIQISSGLTLQFDYRLAWTNQGKCLDLPGGISSDDTRIQT
WECQDGNPNQVWNTGYLSSALPEKSEIGQSGINNCGASNSQDSQCQTAWINDVDDFCLFA
PPSPDSVIGDTERIEVSWCTKAGRGTRLIPDGTLQGVHFVKTQDYVQITGTGDFTRINIR
GGDAGGELDPHGADGNGNPVGGLVFGNSFGQALQYHEWTLFISSSEFCFRACVGPNAARN
CQHIYDVMGCFWNMPGNYDSGVFESCQGDNTEPMGVYGTSTWFQGVDPTPGPHTAGPSSS
CRTIPTVSVTNLRRRLDSVVERRKVRFHP

Enzyme Prediction     

No EC number prediction in KDQ24797.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238092	RICIN	2.42e-04	33	74	85	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
404972	RicinB_lectin_2	2.96e-04	34	72	15	52	Ricin-type beta-trefoil lectin domain-like.
395527	Ricin_B_lectin	6.71e-04	40	72	95	126	Ricin-type beta-trefoil lectin domain.
411519	lectin_2	0.005	35	74	154	198	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
395527	Ricin_B_lectin	0.007	40	84	9	55	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV77601.1|CBM13	2.77e-129	43	328	78	399
QRW06545.1|CBM13	2.77e-129	43	328	78	399
QRV92416.1|CBM13	7.88e-129	43	328	78	399
CCA67406.1|CBM13	8.18e-115	44	307	78	386
CCA67412.1|CBM13	2.57e-114	44	309	79	387

PDB Hits     

KDQ24797.1 has no PDB hit.

Swiss-Prot Hits     

KDQ24797.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000021

TMHMM  Annotations     

There is no transmembrane helices in KDQ24797.1.