CAZyme Information: KDQ24410.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ24410.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	KL198011|CGC12	66355.50	5.7606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198011:724984-727713(+)

Full Sequence      

MSASGVGSEYDIIFAGGGTVACVAAGRLAEADPSLRILLIEQGPHTRNLPAHIHPARFIA
NLVPTSSVFTFHVAQPSEALLGRAPIVPAGRCVGGGSSVNFMVYTRAAASDYDDWETIHG
NTGWGSKDLIPLLQKVETYQDDLSPREEGMHGDSGPIKVSFGGVATEVGKQFMETARAYD
KKHGVTVDSNDFLTINAYSRWMKYIDAKSGKRSDAAHHFIYNQESADSNLHVLANAAVHR
IIIKEHRAIGVEYADSSDHSSKLNSVYAKKLVVVSAGAFGSPAILQRSGIGASQLLKKLD
INEQVDLPGVGENYQDHNLGFATYFVPDCTETLDVFSGHLGEDELKSYVDRWGQHGDGLL
ATNGIDAGIKLRPNEDDLKELGPNFTRIWNNYYKDAPDKPVMMYVPFASHYGPVPDPNGK
YMSMLWFPEYPESIGRLHITSGDDWRQPLYFEPGYLTESADLDILRWAYKRSREVARRMP
LYRGEVQQGHPTFSPNSEAACVSRDGPVPVDAPDIAYTAEDNEAIHDFLRNTVSTTWHSM
GTCAMKPRDRGGVVDSRLNVYGMTNLKVAELSICPSNVSANTYNTALGIGEKAAVIIADD
LGIKLAV

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	602	3.5e-214	0.9966101694915255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.31e-69	9	597	5	531	choline dehydrogenase; Validated
225186	BetA	9.70e-69	3	600	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	2.87e-35	82	317	16	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	7.93e-32	431	593	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.28e-15	2	327	48	335	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96530.1|AA3_3	4.75e-216	10	605	6	600
ALJ82900.1|AA3_3	1.70e-185	8	604	7	605
QRW13540.1|AA3_3	3.57e-171	9	605	7	605
QRW25553.1|AA3_3	9.52e-169	4	605	2	606
QRV98993.1|AA3_3	1.90e-165	9	605	7	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	1.62e-159	9	605	6	628	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	2.58e-158	9	605	6	628	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	3.01e-148	9	602	6	637	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
4YNT_A	2.32e-54	8	600	4	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	5.46e-43	7	598	38	598	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P04841|ALOX_PICAN	2.00e-154	9	602	6	638	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|Q00922|ALOX_CANBO	4.37e-150	9	602	6	637	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	1.55e-147	9	602	6	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	1.55e-147	9	602	6	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|C4R702|ALOX2_KOMPG	1.23e-146	9	602	6	637	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000004

TMHMM  Annotations     

There is no transmembrane helices in KDQ24410.1.