CAZyme Information: KDQ24407.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ24407.1
• CAZy Family: AA9
• CAZyme Description: glycoside hydrolase family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	KL198011|CGC13	35721.73	6.7402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198011:717553-721154(-)

Full Sequence      

MKLLFSFLLITLAGQGAAQLNRVAQAAGKLYFGTATNIEELSDSAYAAIINNRTEFGQIT
AANVMKWDSTEPSRGVFTFGAGDQIAALAKKNNQLLRGHNCVWHQQLPSWVTAGHFDAPT
LSSIVSTHCSALVGHYKGQIWDVINECLNDDGTFRQSVFFDTLNTSFIATALRAARAADP
QAKLYINDFNIEGQGPKSTAMVNLVKSLQAQKVPIDGIGIQAHLLVGGVPPTLLANLKQF
TALGVEVAITELDVRMTLPVTAALLAQQRRDYQTVISACQAVKGCIGVTVWDFSDKYSWV
PGVFSSQGAALPWDDNLAKKPAYDGIVEGFN

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	20	328	9.1e-95	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.67e-145	20	328	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	3.03e-107	65	326	1	263	Glycosyl hydrolase family 10.
226217	XynA	6.15e-79	7	328	11	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR33047.1|CBM1|GH10|3.2.1.8	1.02e-169	20	330	82	394
AEJ35165.1|CBM1|GH10|3.2.1.8	1.91e-169	20	330	80	392
CAB05886.1|GH10|3.2.1.8	1.52e-156	4	331	3	332
CAB05665.1|GH10|3.2.1.8	1.52e-156	4	331	3	332
AWU22293.1|CBM1|GH10	1.74e-152	20	330	86	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	5.66e-123	18	329	1	316	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
3WUB_A	6.63e-118	18	331	3	313	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUF_A	1.33e-117	18	331	3	313	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
6Q8M_A	5.07e-117	17	329	22	338	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1EXP_A	7.25e-97	17	330	1	312	Beta-1,4-Glycanase Cex-Cd [Cellulomonas fimi],1FH7_A Crystal Structure Of The Xylanase Cex With Xylobiose- Derived Inhibitor Deoxynojirimycin [Cellulomonas fimi],1FH8_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Isofagomine Inhibitor [Cellulomonas fimi],1FH9_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Lactam Oxime Inhibitor [Cellulomonas fimi],1FHD_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Imidazole Inhibitor [Cellulomonas fimi],1J01_A Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam [Cellulomonas fimi],2EXO_A Crystal Structure Of The Catalytic Domain Of The Beta-1,4- Glycanase Cex From Cellulomonas Fimi [Cellulomonas fimi],2XYL_A Cellulomonas Fimi XylanaseCELLULASE COMPLEXED WITH 2-Deoxy- 2-Fluoro-Xylobiose [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60206|XLNA_AGABI	2.70e-157	4	331	3	332	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	2.93e-148	13	330	87	406	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	8.72e-148	17	331	81	398	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|Q5ZNB1|XYND_TALFU	3.63e-124	1	329	1	333	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	4.64e-115	18	331	41	351	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999718	CS pos: 18-19. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in KDQ24407.1.