CAZyme Information: KDQ24406.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ24406.1
• CAZy Family: AA9
• CAZyme Description: glycoside hydrolase family 10 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		42698.96	4.4197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198011:715426-717136(-)

Full Sequence      

MKLTLALSSLLALLPLATAEQPAWAQCGGTGWTGDTVCISGWTCVWLNDWYSQCLQPTVT
TTTPSTPTTSTVPTTVPSASPGLDVVAKSKGKLYFGSATDNGELNDAPYAAILSDNKEFG
QITPGNSMKWDATERSRGVFTFSGGDVIANFAAANGQLLRGHTCVWHSQLPGWVTAGNFN
AADLTSIIETHTTTVVDHYKGQSYIYEDAWDVVNEAFNDDGTFRTSVFYTTLGSSYIATA
FHAARAADPDAKLYINDYNIDGLGAKSTAMTNLVAQLKADGVPVDGIGIQGHLIVGAVPN
NLQANFEQFAALGVEIAITELDIRLTLPVTPEKLAQQKADYQKVIAACAAVPACVGVTIW
DWTDKYSWIPSVFSGQGAALPWDETFVKKPAYDGIVAGFGA

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	85	396	8.4e-102	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	2.72e-146	83	397	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	1.56e-108	128	395	1	263	Glycosyl hydrolase family 10.
226217	XynA	4.93e-83	81	396	10	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
197593	fCBD	6.96e-14	22	55	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	3.56e-13	23	51	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU22293.1|CBM1|GH10	4.40e-285	1	401	1	400
AEJ35165.1|CBM1|GH10|3.2.1.8	7.36e-190	7	401	6	394
AFR33047.1|CBM1|GH10|3.2.1.8	7.49e-188	7	401	6	396
AAG44992.1|CBM1|GH10|3.2.1.8	1.23e-177	1	400	1	407
ABZ88797.1|CBM1|GH10|3.2.1.8	1.75e-177	1	400	1	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.13e-140	82	401	2	319	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	5.13e-133	82	400	24	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	3.08e-124	83	397	5	310	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	4.36e-124	83	397	5	310	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3CUF_A	1.34e-105	95	401	15	314	Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HEZ1|XYNA_PHACH	3.11e-178	1	400	1	407	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	8.65e-176	2	401	3	399	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|O60206|XLNA_AGABI	2.38e-152	83	399	19	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B4XVN1|XYNA_STRSQ	3.28e-121	83	397	43	348	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|Q5ZNB1|XYND_TALFU	1.88e-114	83	398	21	333	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999737	CS pos: 19-20. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in KDQ24406.1.