CAZyme Information: KDQ24137.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ24137.1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 47 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		50634.95	4.7988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198012:1752022-1753827(+)

Full Sequence      

MIDSMDTMWIMGLRDEFDNAVRVASQQNFTTVSSTYAPFFETVIRYLGGLLSAHALSGEA
ILLDRANDLGNRMLPVFDTPSGLPRFSVNTATGQTALGWTGNAVLFSEATSCQVEYKYLA
HVTGRSEYYDKVENIMDKMYHANVSDGLFTTRWDAADASPMNNHFSVGASADSGYEYLLK
QYLISGKTEPRAKDQYLASTNGIINKLLYISPHRKLLYVTDVASGRPIYDLQHLSCFLPG
LFALGVHALDLSPRDKELHTWVAQGLAYTCWLTYADQATGLGPDGVQFDEQSRLWVDALA
EWERGGREGGAPPGVSEVPEEHAADKRDYRVSSSVYLLRPETVESLFLMWKTTRDVRWRE
RGWAIYEALEKHTRVEHGYAIIRNVDQVPAETSDDMPSFFLAETLKYLYLLFAETDIIPL
DKWVFNTEAHPLPIFTWSPTEQEQHNAMS

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	434	4.6e-123	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.18e-155	1	434	37	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.37e-134	1	435	114	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA68935.1|GH47	4.06e-139	1	444	121	576
QRV84897.1|GH47	5.86e-136	1	445	137	645
QRW13489.1|GH47	5.86e-136	1	445	137	645
QRV98941.1|GH47	1.17e-135	1	445	137	645
QRW25887.1|GH47	1.25e-121	1	446	118	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FMI_A	5.94e-84	1	436	52	458	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	6.28e-84	1	436	52	458	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	2.79e-83	1	435	47	452	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	3.03e-83	1	436	47	453	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	4.98e-83	1	436	130	536	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18498|MA1A1_SPOFR	4.97e-88	1	434	244	644	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|P53624|MA1A1_DROME	1.38e-86	1	434	247	647	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
sp|B2GUY0|MA1B1_RAT	5.21e-83	1	439	249	656	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	1.11e-81	1	439	250	657	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q18788|MAN12_CAEEL	3.57e-81	1	436	186	589	Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans OX=6239 GN=C52E4.5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ24137.1.