CAZyme Information: KDQ23889.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ23889.1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		58514.62	6.3094

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198012:979521-981760(-)

Full Sequence      

MPPSVTIISHTTASVPRPHILYSIQVNIDGKRRVVDKRYSEFVQLHDSLHDPFTLPPKRF
LVTTFIPSAWVDDVVAERKTGLASWLRDLLSSDDFKDNSALLAFLTPDASATPRHFSLED
VLPSTLSRKAGMKFAPEDEVDTMATPIAAAYYPDWSAGSNPPEKIDFSKFDILFFAFAMP
NSSSTLTWDSGAQDILRRLVTSARNSGKGTKIVLSVGGWGGSTWFSQAMSSSANRTTFKN
SLTSAVNSFGLDGVDIDWEYPNSTGAGNPHSSADAANLLSFFQTLRGALGASKILSAAVP
HLPWLGANGQPLTNVSSYAAQLTYVNIMNYDVWGASSNPGPNAPLGNLCGTSSQPQASAQ
AALAQWKNAGFPANKLLLGLPLYGYVSQSTRTGLSGSLMPSEDMLLLQEANSPADASKRE
FLNGAHARPKEQKVSVEASGDLNGWFGQQIPFNSLVASGALVKKSDGTYGQGAGYTMAWD
DCSDTPFLYNVSRRTVVTYDDTWSLGDKALFAKQNGMAGCFTWSLDQDDGVTLQNVIRKN
LGK

Enzyme Prediction     

No EC number prediction in KDQ23889.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	149	532	6.3e-62	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	7.88e-53	149	528	3	334	Glyco_18 domain.
119365	GH18_chitinase	4.84e-47	149	528	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	2.67e-46	149	528	3	307	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	2.24e-36	149	332	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
225862	ChiA	2.84e-36	146	542	38	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX66486.1|GH18	9.41e-103	142	528	166	517
CBQ71457.1|GH18	2.56e-102	142	528	165	516
CDI56735.1|GH18	5.54e-98	138	528	159	530
CDU24651.1|GH18	1.36e-96	139	528	169	522
QRV73087.1|GH18	3.75e-96	138	542	114	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	3.14e-50	149	538	5	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	1.47e-29	187	541	101	419	Chain A, Glycosyl Hydrolase [Niallia circulans]
6KST_A	4.59e-29	150	541	11	370	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	2.15e-28	150	541	11	370	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	2.53e-27	162	541	25	370	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	5.76e-28	187	541	133	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q6RY07|CHIA_RAT	4.41e-22	151	529	27	366	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q91XA9|CHIA_MOUSE	5.92e-22	151	529	27	366	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|Q95M17|CHIA_BOVIN	7.87e-22	151	529	27	366	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q60557|OVGP1_MESAU	7.12e-21	151	529	27	361	Oviduct-specific glycoprotein OS=Mesocricetus auratus OX=10036 GN=OVGP1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000005

TMHMM  Annotations     

There is no transmembrane helices in KDQ23889.1.