CAZyme Information: KDQ23613.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ23613.1
• CAZy Family: AA5
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A067N6E3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	KL198012|CGC6	41780.17	7.6086

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198012:201432-203062(+)

Full Sequence      

MVILASYCRVFLLLAASTVGLVSGLTIQNGDPRIHYHGRWDDSPGTWWAGSGLKLHVQNA
KTMKIRLGSLTTSPFAALGVSVNYEPFFTVNASVGWNDIPLPAAPRFKRSDKSVIRLNVE
GWQNNRINLETIVFNRGAQLLPYKPSKLSFQFIGDSLSAGQYLPLGVDQAWPFLVGENFK
AEHTINAQPGATLTDIPSYGNVHGVSFQFFKTEDTGYVWTSDHNYTTPWDFRRDRPSPTH
VVIHIGANDVSQGVTPDQFVQEYLDFLKRLRTIYRTQSIFVFTPWGWPSADGNVWYYYDG
KYEEIVRKQTALGDSRIFLVNTTGWVTFDDVFADNQHPNVPGHVKIANLFSEWLKDWGLR
PERQWATLA

Enzyme Prediction     

No EC number prediction in KDQ23613.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	151	351	4.3e-23	0.9712918660287081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	5.18e-16	152	355	4	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	2.17e-11	152	343	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.16e-08	152	350	3	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238871	XynB_like	3.86e-07	241	352	44	155	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	5.47e-06	152	355	13	209	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA73290.1|CE0	2.10e-146	21	369	9	358
QRV98465.1|CE0	3.61e-140	25	365	27	368
QRW13030.1|CE0	5.12e-140	25	365	27	368
QRV84417.1|CE0	2.07e-128	25	365	27	353
QRW17577.1|CE0	1.18e-121	14	367	10	360

PDB Hits     

KDQ23613.1 has no PDB hit.

Swiss-Prot Hits     

KDQ23613.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999739	CS pos: 24-25. Pr: 0.9744

TMHMM  Annotations     

Start	End
5	27