CAZyme Information: KDQ23481.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ23481.1
• CAZy Family: AA5
• CAZyme Description: carbohydrate esterase family 15 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		46522.29	7.6393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198013:1426066-1427687(-)

Full Sequence      

MKYLRLLAAVAVAAPGVLAIPEASAGAEACLRGTAPPAPTTSAPAPPTTISAPPTTVAPP
ATSAPTSSGPTPTAPASCAAIPASISFSNAALPDPFQPVAGGARISTKAQWTCQRNEISQ
LLQRYELGTMPPKPQSVTASFSGGTLTINVSDQGKSISFAVKITTPSGSGPFPAIIAYGG
PSIPIPNNIGVITFNNDDMAAQQSGSSRGQGKFYQLYGSGHSAGAMTAWAWGVQRIIDAL
EITPAANVDLTRIGVTGCSRNGKGALVAGAFDERIALTIPQESGSGGSASWRLSNFQQSQ
GQNVQTAPEIVQENVWFSPNFNSWVNQVNSMPVDHHQLTAMVAPRGLFVIENTSMEWLGA
LSTYGCQRASKLIYQALGASANMGYSQVGNHNHCAFPSSQQTELTAFLNKFLLNGSGTTD
IFRTDTTYSNFDQTRWIPWSVPTLS

Enzyme Prediction     

EC	3.1.1.-:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	92	413	1e-93	0.9888475836431226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223021	PHA03247	1.49e-07	27	109	2724	2815	large tegument protein UL36; Provisional
223021	PHA03247	2.34e-07	36	184	2702	2858	large tegument protein UL36; Provisional
411345	gliding_GltJ	3.27e-05	21	83	396	457	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
237865	PRK14951	3.55e-05	22	117	383	492	DNA polymerase III subunits gamma and tau; Provisional
237030	kgd	4.57e-05	21	104	44	125	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX47404.1|CBM1|CE15	1.15e-169	88	445	109	466
CCA74892.1|CBM1|CE15|3.1.1.-	1.95e-166	92	445	116	469
UKZ65966.1|CBM1|CE15	3.20e-157	88	445	104	457
VBB74964.1|CBM1|CE15	4.72e-155	92	445	123	481
CAP60908.1|CBM1|CE15|3.1.1.-	6.69e-155	92	445	123	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PIC_A	8.74e-153	88	445	22	375	Chain A, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	2.58e-136	86	445	12	380	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	6.86e-136	86	445	18	386	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]
6RV8_A	3.38e-135	86	445	90	458	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
4G4G_A	4.21e-132	88	445	55	411	Crystal structure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ABS0|GCE1_PODAN	1.19e-155	92	445	123	481	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
sp|G0RV93|GCE_HYPJQ	8.24e-151	88	445	107	460	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
sp|A0A1D8EJG8|GCE1_SODAL	5.33e-145	89	444	140	495	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1
sp|A0A0A7EQR3|GCE_CERUI	1.38e-134	86	445	106	474	4-O-methyl-glucuronoyl methylesterase OS=Cerrena unicolor OX=90312 PE=1 SV=1
sp|Q7S1X0|GCE_NEUCR	1.47e-132	92	445	43	394	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999659	CS pos: 25-26. Pr: 0.7940

TMHMM  Annotations     

There is no transmembrane helices in KDQ23481.1.