CAZyme Information: KDQ23245.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ23245.1
• CAZy Family: AA3
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	KL198013|CGC11	65019.17	5.7349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198013:710512-712464(-)

Full Sequence      

MTEVVPQAPAPAAAEVPQKPLGQHTFLPNGMLEVNPEGAHPIYTLVKDAEERWNEKVSRA
SKSLEEAIAEYKRRYKRPPPKGFDDWWEYVVQNNVQLPDEYDQIHRDLEHYWGIEPRDLR
KIQKELETKLDSYTLGKTETGPVEVVTSSFQEGRYNQLIVGSVRIIGLLEEIDDVLPAFR
ATFSPHDGPNRLTDYGIQQAVLKAAREYEPIEIDDLPKINPIGWVSACSPDSPARQFKID
LDNPPPPPPNKSFIYDHRLAMDPCNHPQLFFQHGQFLSHNYGPTPQKEMVPEFSQCSSTL
HHNIRIPTPYGWVDDIYPRADDPDFDDKPDERLLWRGSNTGIFHSSTSRWKPAHRNRLIE
FTNDLNGTANILPPNKTQDEPIGDGIPYRKSRLNPALLDIAYSGSPHSCAEPVCKQLATM
YEWRRMQSIKEAGSYKYVLDVDGNGWSGRFKRLITSNSLVFKATIYPEWYSDRIQPWLHY
VPVQVDLSDLHDSLLFFRGDPSGVGAHEDMARRIAVTGREWSRTYWRREDLIAYFFSRLI
LEYVRLLSLDRDAMSLRSEEKYIE

Enzyme Prediction     

No EC number prediction in KDQ23245.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	286	547	1.6e-58	0.908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.43e-16	435	547	146	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.37e-11	435	547	216	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV89460.1|GT90	1.81e-160	21	560	114	653
QRW03676.1|GT90	2.90e-159	24	560	117	653
QRV74770.1|GT90	2.90e-159	24	560	117	653
CCA67199.1|GT90	2.26e-150	21	564	87	631
CDR40950.1|GT90	8.88e-119	24	556	146	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.03e-13	391	548	197	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.68e-93	40	552	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.24e-12	391	548	225	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	3.69e-12	391	561	322	483	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.70e-12	391	546	323	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	4.31e-12	391	548	225	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ23245.1.