CAZyme Information: KDQ23206.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ23206.1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 71 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	KL198013|CGC7	49517.13	4.8655

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198013:592460-594136(+)

Full Sequence      

MLAFLSQLLITCLAVALVVSAITIPQVSSPELASPPRADAAKVVVAHLMVANTFHYTPAD
WEQDISLAASSGLDAFALNIGYGEWYPNSVEAAYTAALNYPNFKLFISFDMTSIPCSSAD
NADAMHELIAKYRLHPSQLQYKGGPLVSTFGGEHCYFGKESVNEGWASVMKRDHPGCTFI
PSFFIQPAASKDYSVLDGIFPWNSAWPLGPTDISFNYDREFISGLRIDQSYMAGVSPWFF
THYGFPYNKNFIFRGDDWLLATRMEQLVQNRNEIGLVEVITWNDYGESHYVGPIHGDQPG
SEEWVNGFDHQAWLPLLSYYITAFKTGVYPMGKERIFLWMRPHPTAASASDPLGRPANAD
WTEDYMWVVALLDAPGDITLSCGPSNEVTSFTTPGLQKAKLPLKADCQPHAAITRGGVPV
VILDPQEISFKMQPGRYNFNAYVAASL

Enzyme Prediction     

EC	3.2.1.59:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	44	419	1.4e-104	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	3.76e-154	44	421	1	371	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	3.70e-97	38	327	1	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	7.91e-28	44	322	1	284	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA70335.1|GH71	2.79e-114	49	443	60	473
QRV98082.1|GH71	1.78e-108	49	441	42	514
QRW25381.1|GH71	2.29e-107	49	441	38	507
CCA71563.1|GH71	2.66e-106	49	446	235	653
VWP00414.1|GH71	2.88e-105	49	444	41	475

PDB Hits     

KDQ23206.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	6.46e-79	49	442	29	418	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	9.65e-51	49	446	43	430	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	7.38e-37	49	440	18	425	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.041693	0.958263	CS pos: 21-22. Pr: 0.8082

TMHMM  Annotations     

Start	End
2	24