CAZyme Information: KDQ22669.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ22669.1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	KL198014|CGC3	55200.36	6.4156

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198014:1943100-1944803(+)

Full Sequence      

MSLLKVSGTKIVDEGGKEVILRGAGLGGWMNMENFISGYPGCEYQIREALAETIGQEKSE
FFFDKFLEYFFLEDDAKFFRGLGLNCIRLPFNYRHFEDDLNPRVLKTSGFKHLDRVINIC
AQHGIYTILDMHTAPGGQNTDWHCDSGTHQAAFWIHKDFQDRSIWLWEELAKHYAGNKWI
AGYNPLNEPTDPTQTRVVALYDRVYQAIRAIDPEHVIFFDGNTFASDFSHFGDIHKKWSN
TAYSIHDYSLFGFPAAPEQYIGSSEQKRRLKRSYEKKREWMDQRGLCVWNGEWGPVYARK
QYEGEATDQINEIRYKVLKDQLEIYNHDRLSWSIWLYKDIGFQGMVYTSLDTPYMTLFSK
FLAKKHRLAVDAWGADDQHVRRIYQPLIDHIIEEVPQEFRNLYPYPVWTLSGRVGRLARN
LLVSEFLVKEWAAHFVGKSEEELDSIAASFKFDACLHRDGLNRILTDNAKAVSE

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	340	2.5e-123	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.81e-26	12	339	1	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.97e-13	69	338	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHL69750.2|GH5_22|3.2.1.37	4.18e-291	1	474	1	474
AIA81045.1|GH5_22|3.2.1.37	4.18e-291	1	474	1	474
EGX46484.1|GH5_22	2.81e-239	3	465	9	473
CCA72702.1|GH5_22	2.02e-236	2	474	5	479
CCA66460.1|GH5_22	1.57e-232	4	470	7	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W0K_A	2.00e-15	78	338	30	294	Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
1EQP_A	7.95e-11	20	192	8	190	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	8.11e-11	20	192	13	195	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.87e-10	20	192	8	190	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3N9K_A	1.91e-10	20	192	13	195	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	7.42e-292	1	474	1	474	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P16169|GUNA_RUMFL	2.07e-13	20	217	7	171	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
sp|P29717|EXG1_CANAL	4.74e-10	20	192	52	234	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|A2QX52|EXGD_ASPNC	1.74e-09	21	189	420	598	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgD PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	1.03e-08	21	192	37	218	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KDQ22669.1.