CAZyme Information: KDQ22559.1

Basic Information

• Species: Pleurotus ostreatus
• Lineage: Basidiomycota; Agaricomycetes; ; Pleurotaceae; Pleurotus; Pleurotus ostreatus
• CAZyme ID: KDQ22559.1
• CAZy Family: AA2
• CAZyme Description: glycosyltransferase family 90 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	KL198014|CGC8	69640.47	7.3167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PostreatusPC15	12460	1137138	164	12296

• Gene Location: location=KL198014:1626627-1628799(-)

Full Sequence      

MKLQIHKALPQWQGHQTLCLLLALALFLTVVYLRESLISIALEAQGPIFWRRPPTADFSR
ADGLFEDKRRGRHPVIELIERAEREWEGKHERASKTLSEAVAEYKRRYKRWPPKGFDDWW
QYVQDNDVKLPDEYDSIYEDLEPFWGIRPRDLLQIQAAQENIPDAYIIAKEPNASIGIAN
VVRSRINPMPMEALISGYQGLFNILKPVEHMLPPFRIPVSPHDSPNLVSDYDVKTAALTA
AGAGKYVNLAISPKMPRLGFASACPPDSPARKGKIIDQAKRPPPRKEKTFIYDHRRAMDP
CHSPHLFFSHAQFLPYPPTTPHAQSLMSAQATYCNTMVHHNIQLPSLISWVDDIHPREND
PPWANKTDERMFWRGSNTGLTFSAETLWRYSQRPQLVKLANDMEGAVRLRVPTGNDHPQS
ESPPYELVDVPRRHLNTAFFDVKFAGSPIACAPEYCELLEHEFEWKPHVPFNDPGVGAHK
YFIDVDGNGWSSRFKRLITTNSLVFKATIYPEWWLERIQPWVHYVPIQVDLSDLYDIFAF
FRGGMYGKGNHDEMARKMAEAGREWSRTYWRKEDMTAYLFRLLLEYGRVMSLDREAMTYQ
PE

Enzyme Prediction     

No EC number prediction in KDQ22559.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	333	590	9.5e-61	0.872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.79e-18	479	590	146	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	9.86e-14	479	590	216	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV89460.1|GT90	6.79e-126	43	599	103	649
QRW03676.1|GT90	7.52e-125	43	599	103	649
QRV74770.1|GT90	7.52e-125	43	599	103	649
CCA67199.1|GT90	3.79e-119	60	600	93	624
CDR40723.1|GT90	2.47e-104	62	599	198	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	9.98e-13	479	591	237	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.33e-78	73	595	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	2.52e-13	468	589	353	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	1.35e-12	468	589	352	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	6.42e-12	479	591	265	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.29e-11	468	589	353	466	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999975	0.000050

TMHMM  Annotations     

Start	End
20	42