CAZyme Information: KAG6623593.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6623593.1
• CAZy Family: PL3
• CAZyme Description: ricin B lectin-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829		92472.18	5.2129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000001:4173073-4176665(-)

Full Sequence      

MASQATSKATSKPSEAPRSFPSLLSVAVALAAVIAAAWTVVDPSQLQARVQLLVDNYVGV
SLGETVPGDTLVDCLRAQRYLTDELSVKGFHVLCIKKVQEEEGESLATLDVVAFKDGIAP
AMTTQSSVELDDLKVKLETLLDIHAPTDDVAVKYKQPYAFFTPDGERLERLQEMVNRVVF
LFEGGQFIWPGIRVGHKTVVKNVAGKGDVVLETLSMVPLVFSVEEFLKDDEIDVIMNLSL
EQLKPSTVTLMDGHENRAATDWRTSTTYFLPSDAHPKIEEIDQRVADLTKVPIDHQEDVQ
VLRYEETQKYDHHTDYFPVEHHKNSPHVLESIDYGYKNRMITVFWYMSDVAKGGHTIFPR
AGGAPRPVSMKDCTKGLKVPPKKRKVIVFYSMLPNGEGDPMSLHGGCPVEEGVKYSGNKW
LALSIFLVDDQASLKMKLYFPALASSVFVTLYGGVNAVPSVSGVNYDARNGSDWETNNSN
CKSFNDVYHDMLTLQTFTDKIRVNSLVQCDVANLVLQFAASIGVKVDLGITTAKGRDYIH
VGSGAISRDNVTVDTAISYMNEIRDFIRSSGKNTSVTITDTIDLYNANPQLLEAVDYVSV
NYSPFWERVDVNEGVAATLDRLRGLRKTAANKDKSVVVSETGWSSGGTNPVPDMASPANQ
AKYFSDFVLVAHSHKDLNDYWSDAFDANWLNEKVVEAHLGVYLKAGQMKDDIFKLENNWR
EQQTWFFDSTTQQIRSKSSDRCLDAYQPWDGGKVHVYRCMDNEPNQKWTYDNATSTLQHA
THKGFCLDQDSAQNNKVQLYGCSTNNTHEKWDPNTLYCQVGPFCNPNEQ

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177683	PLN00052	1.47e-37	211	421	47	250	prolyl 4-hydroxylase; Provisional
227625	Scw11	2.29e-27	460	702	44	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
214780	P4Hc	1.19e-26	229	420	2	163	Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.
395527	Ricin_B_lectin	2.27e-20	717	811	32	126	Ricin-type beta-trefoil lectin domain.
404519	2OG-FeII_Oxy_3	1.14e-14	299	421	1	93	2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18032.1|CBM13|GH17	2.41e-123	436	793	1	417
QBC18038.1|CBM13|GH17	2.41e-123	436	793	1	417
QBC18040.1|CBM13|GH17	2.41e-123	436	793	1	417
QBC18039.1|CBM13|GH17	2.41e-123	436	793	1	417
QBC18034.1|CBM13|GH17	2.41e-123	436	793	1	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JIG_A	2.70e-29	206	421	10	215	Crystal structure of Chlamydomonas reinhardtii prolyl-4 hydroxylase type I complexed with zinc and pyridine-2,4-dicarboxylate [Chlamydomonas reinhardtii],2JIG_B Crystal structure of Chlamydomonas reinhardtii prolyl-4 hydroxylase type I complexed with zinc and pyridine-2,4-dicarboxylate [Chlamydomonas reinhardtii]
3GZE_A	2.77e-29	206	421	11	216	Algal prolyl 4-hydroxylase complexed with zinc and (Ser-Pro)5 peptide substrate [Chlamydomonas reinhardtii],3GZE_B Algal prolyl 4-hydroxylase complexed with zinc and (Ser-Pro)5 peptide substrate [Chlamydomonas reinhardtii],3GZE_C Algal prolyl 4-hydroxylase complexed with zinc and (Ser-Pro)5 peptide substrate [Chlamydomonas reinhardtii],3GZE_D Algal prolyl 4-hydroxylase complexed with zinc and (Ser-Pro)5 peptide substrate [Chlamydomonas reinhardtii]
2JIJ_A	3.39e-29	206	421	19	224	Crystal structure of the apo form of Chlamydomonas reinhardtii prolyl- 4 hydroxylase type I [Chlamydomonas reinhardtii],2JIJ_B Crystal structure of the apo form of Chlamydomonas reinhardtii prolyl- 4 hydroxylase type I [Chlamydomonas reinhardtii],2JIJ_C Crystal structure of the apo form of Chlamydomonas reinhardtii prolyl- 4 hydroxylase type I [Chlamydomonas reinhardtii]
2V4A_A	1.58e-28	206	421	19	224	Crystal structure of the SeMet-labeled prolyl-4 hydroxylase (P4H) type I from green algae Chlamydomonas reinhardtii. [Chlamydomonas reinhardtii],2V4A_B Crystal structure of the SeMet-labeled prolyl-4 hydroxylase (P4H) type I from green algae Chlamydomonas reinhardtii. [Chlamydomonas reinhardtii],2V4A_C Crystal structure of the SeMet-labeled prolyl-4 hydroxylase (P4H) type I from green algae Chlamydomonas reinhardtii. [Chlamydomonas reinhardtii],2V4A_D Crystal structure of the SeMet-labeled prolyl-4 hydroxylase (P4H) type I from green algae Chlamydomonas reinhardtii. [Chlamydomonas reinhardtii]
3ITQ_A	2.51e-18	218	421	39	210	Crystal Structure of a Prolyl 4-Hydroxylase from Bacillus anthracis [Bacillus anthracis str. Ames],3ITQ_B Crystal Structure of a Prolyl 4-Hydroxylase from Bacillus anthracis [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8LAN3|P4H4_ARATH	1.58e-31	211	426	37	248	Probable prolyl 4-hydroxylase 4 OS=Arabidopsis thaliana OX=3702 GN=P4H4 PE=2 SV=1
sp|F4JAU3|P4H2_ARATH	7.43e-31	211	426	38	249	Prolyl 4-hydroxylase 2 OS=Arabidopsis thaliana OX=3702 GN=P4H2 PE=1 SV=1
sp|Q9LN20|P4H3_ARATH	1.91e-30	206	421	71	280	Probable prolyl 4-hydroxylase 3 OS=Arabidopsis thaliana OX=3702 GN=P4H3 PE=2 SV=1
sp|F4JNU8|P4H8_ARATH	1.28e-29	205	420	74	283	Probable prolyl 4-hydroxylase 8 OS=Arabidopsis thaliana OX=3702 GN=P4H8 PE=3 SV=1
sp|F4JZ24|P4H10_ARATH	7.78e-29	211	428	78	289	Probable prolyl 4-hydroxylase 10 OS=Arabidopsis thaliana OX=3702 GN=P4H10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999285	0.000751

TMHMM  Annotations     

Start	End
20	42