CAZyme Information: KAG6623517.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6623517.1
• CAZy Family: PL3
• CAZyme Description: putative xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		46465.44	4.9143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000001:2594094-2595545(+)

Full Sequence      

MKCTIALAVGIGSLNVVAGDSITKSTYSGSSGLNDMAKAAGKYMGTAVDQDMKDSAALKV
LKNSHDFSMITPGNSMKWDATEPTQGSFTFDGGDAVVALAKEMGAQVRCHTLTWHSQTSQ
WVQGLSKEQMLSALENHITKVMTHFGDSCYAWDVANEVMGDNAQMRDSFWYKTTGMDFLT
TAFKTANQVKKSLGLKTKLYYNDYNTNTINAKSTAVLNMIKKLLDDGITVDGVGFQSHCA
SSDTSSAADLAANLERFTALGLDVALTEVDVTASSSSPSAEEQTQQSNVYTNIVAACKQV
EKCVGVTIWGYDDNYSWLSTKAPLPWYQPGGANSELVRKSLYDGIVAGWGGSSATQSKNT
PQTYGSGSGVTNTTQTSAASTSAPSTEAPSTQAPSTQAPSTQEDPSTWTNQYSWGFGKTG
GVNPGTVAPANDIYQQN

Enzyme Prediction     

EC	3.2.1.8:2	3.2.1.4:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	34	344	9.3e-94	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	9.79e-118	33	347	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	7.93e-99	76	329	1	256	Glycosyl hydrolase family 10.
226217	XynA	5.27e-70	65	329	56	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63054.1|GH10	6.44e-210	1	365	1	362
AOV63055.1|GH10	4.72e-162	18	350	17	351
AOV63057.1|GH10	1.44e-128	1	349	1	353
AOV63056.1|GH10	2.16e-126	1	349	1	357
UIZ24493.1|GH10	1.45e-115	1	349	2	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.66e-86	32	350	2	318	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
5XZO_A	2.22e-72	32	346	2	330	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6Q8M_A	3.96e-69	32	350	24	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
1NQ6_A	8.76e-69	33	347	4	300	Crystal Structure of the catalytic domain of xylanase A from Streptomyces halstedii JM8 [Streptomyces halstedii]
3WUF_A	8.17e-66	33	347	5	310	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J1Y4|XYN5_MAGGR	1.19e-70	29	323	34	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|G4MLU0|XYN5_MAGO7	1.19e-70	29	323	34	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|O60206|XLNA_AGABI	2.36e-70	33	349	19	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	9.98e-70	33	350	94	407	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|Q5ZNB1|XYND_TALFU	1.06e-68	33	348	21	333	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001986	0.997963	CS pos: 18-19. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in KAG6623517.1.