CAZyme Information: KAG6623502.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6623502.1
• CAZy Family: PL3
• CAZyme Description: glycosyl hydrolase family 17-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	JAFJYM010000001|CGC6	31170.07	6.5940

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000001:3331651-3332517(-)

Full Sequence      

MVSLLNMAVVAAASSIATGFVDASKLSSGVCYAPWHHPTVNWDVLAGDMKQVSEHFSSIR
TYQAQFNGVNAISMAAAAGLHIAVGVQLTDPRWIDSEIQAVCDGYAKNAWAVEAVYVGNE
DLKNGNFGVYSADQIAGYIRRVKSCVGNTPVGSAQRINEWLGADGAWTLANACDVIGVNI
HPFFTPGSQPAVKKLEAQWGQMTSKFGSGKVRLTETGWPYAGSSYAGNVPSKGAMTQYLY
DYVYGWCPGKSQSYWFMMYDTTVSYSGADYEKHFGLFGTDKSQHISMP

Enzyme Prediction     

No EC number prediction in KAG6623502.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	29	283	5.7e-16	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.08e-21	43	281	63	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.46e-04	203	283	219	303	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	4.90e-159	1	288	1	288
UIZ21797.1|GH17	2.65e-95	22	288	567	834
UIZ21931.1|GH17	5.99e-94	1	288	1	288
UIZ21795.1|GH17	4.53e-70	1	201	1	202
CCA18992.1|GH17	2.27e-39	29	288	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.07e-10	38	282	50	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.04e-09	38	282	50	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	9.23e-13	53	230	337	516	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	9.23e-13	53	230	337	516	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	2.21e-12	53	230	324	503	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	1.12e-08	53	232	337	518	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q5BD29|BTGE_EMENI	3.58e-08	13	236	283	509	Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.705838	0.294183

TMHMM  Annotations     

There is no transmembrane helices in KAG6623502.1.