CAZyme Information: KAG6623335.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6623335.1
• CAZy Family: PL1|PL1
• CAZyme Description: Lysosomal beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807		88154.89	6.1822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000002:405242-407738(+)

Full Sequence      

MASEDAQLNSFSNSLRNRKERRKEPYKGRMPRLGLFMLATFASVAVFSAANETMTDQHVQ
DRVEELMSSMDLDTMLGQMTQLDISTIMHPNRTLNRAIVHEHARLSVGSYLNTPGAALND
SNSNSTHNFSPKEWRDLVRDIQDIYASHGSHPVLYGLDSVHGADYVRGAVLFGQQLNAAA
TFNPNLVYDMGRITARDTAAAGIPWLFAPILEISQNPLWARTFETFGEDPHLVSVMADAI
VRGIQSNGTTAACMKHIIGYSKTPTGHDRAGVTVSDFDLLNHFAPSFLAAIKAGAMTAME
SYISINGVPVVANTKILRDLVRHDMGFQGLIVTDYSEIHNLHVWHRVASTDQDAVRMALT
NAPLDMSMVSYNTTFIDMARLTVQENPELLDRVKASARRIITTKVKLDLYENALPGTASD
ISLVGQNESRQAALELARESIVLLKNEDGLLPLSPDSDIFLTGHAADNVGLLCGGWSLRW
QGVSGNSLFPNGISLRQGIANVLNTSSGSFQYANDLHPNGSYSSVALQFITNRAAQSKYT
VIAIGEGAYAEKPGDLDDLNLPRGQVDYVREVAATGTKVILVLAQGRPRLLQGLAELAHA
VVYAMLPGELGGQALAEILFGRVNPSGRLPITYPKTPANIAIPYNHLVSTRCRDEGPCEM
EWHFGHGLSYSVFEYGSVSLSKNSICGSDDASLEVSVTVTNAGSMTGKETVMLFLIQPFR
AISVPEVKQLKKFAKIHLQPGETQVVSFTLTREDWGVFDPQIGSGFRRIVEPGRYFVAVK
PETDCNVYNEGDAKSSGLCAQFTIQDN

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	150	369	2.6e-58	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.60e-113	30	779	1	750	beta-glucosidase BglX.
224389	BglX	5.49e-64	130	490	42	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.03e-54	166	750	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.00e-46	72	402	2	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	4.01e-46	441	670	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27116.1|GH3	0.0	79	807	1	727
CCA27737.1|GH3	1.93e-291	62	804	67	808
UIZ29009.1|GH3	5.28e-290	44	804	16	762
UIZ29613.1|GH3	9.61e-265	33	804	47	819
UIZ29432.1|GH3	1.06e-262	33	804	2	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.72e-120	55	754	9	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	6.05e-83	63	805	14	752	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.10e-82	63	805	14	752	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5M6G_A	3.58e-81	33	636	19	590	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6R5I_A	6.45e-80	138	779	58	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	9.51e-143	63	779	80	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.00e-119	55	754	31	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.36e-77	33	779	7	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	3.04e-77	51	779	26	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	4.20e-77	51	779	26	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.931790	0.068206

TMHMM  Annotations     

There is no transmembrane helices in KAG6623335.1.