CAZyme Information: KAG6621360.1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: KAG6621360.1
• CAZy Family: GT71
• CAZyme Description: putative chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22052.27	4.3779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiGKB4	19981	N/A	0	19981

• Gene Location: location=JAFJYM010000008:1198250-1198846(-)

Full Sequence      

MFPDAVSLYNFNGLVNAASKYTEFANTGNNDNDKRELAAFLAQTAHECDSYKAAEEYAWK
TYSVWQYCNNSTISCAPGRRYHGRGPIQLSWNYNYYHAGEALGIDLLDNPDIVATDTDVT
WMTALWYWMTPQGQGSQAIHDVVTGENGFAEATKIINGDLECGPNAPNKANEQQRIEYYT
KMCEALNVQPLGSTSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	4	196	1.8e-64	0.8831168831168831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	4.95e-67	1	196	9	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	5.32e-54	5	196	21	232	Chitinase class I.
225720	COG3179	3.23e-09	1	158	12	185	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN31509.1|GH19	1.43e-124	1	198	39	234
CCD28125.1|GH19	1.06e-116	1	198	65	260
UIZ22871.1|GH19	1.21e-114	1	198	60	256
AKJ27151.1|CBM12|GH19	1.38e-56	1	196	171	363
UDF35743.1|GH19	1.43e-56	1	196	44	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	1.85e-52	1	196	11	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	4.15e-49	2	196	17	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	2.29e-48	2	196	16	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
7V91_A	2.31e-46	5	196	25	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V92_A	2.31e-46	5	196	25	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P86473|CHIT_ACTCC	1.81e-47	7	196	98	307	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|P52405|CHI3_SOLTU	3.26e-47	7	196	94	303	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
sp|P05315|CHIT_SOLTU	1.17e-46	7	196	104	313	Endochitinase OS=Solanum tuberosum OX=4113 PE=2 SV=1
sp|Q05538|CHIC_SOLLC	1.42e-46	7	196	98	307	Basic 30 kDa endochitinase OS=Solanum lycopersicum OX=4081 GN=CHI9 PE=1 SV=1
sp|P52404|CHI2_SOLTU	1.73e-46	7	196	92	301	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG6621360.1.